ESTScan Details for Unigene SGN-U322309

Score 
1023
Direction 
Forward
Predicted Peptide Sequence 
MDEASRDGPTNKVRARMSIASALIFGSVSGGWADHKRQYKTGWDXLQVAAINTAMAALTKTVGVFPKERAIVDRERAKGSYALGPYLLSK
LIAEIPVGAAFPLLFGGILYPMARLHPTISRFGKFCAIVTVESFAASAMGLTVGAMVPTTEAALALGPSLMTVFIVFGGYYVNSDNTPII
FQWIPRVSLIRWAFQGLSINEFSGLQFEHQKTSDIQSGEQVLERLSFGSSRIGDTIIAQREYSCFGITQLPSPGENKPKYQRLEPPLRLK
DIEEEPEEEAKLQPVKDDDLPEPTQQVESPPSDEGKPDEQQESSPADPLDLFTLDXLVNCXGKMDDVDNEDMDFFIDLSPTGAYQKEMLX
AVKGAXFYVSY
Predicted Coding Sequence 
ATGGATGAAGCTTCTCGTGATGGACCAACAAACAAAGTTCGGGCAAGGATGTCAATTGCTTCAGCTTTGATATTTGGTTCTGTTTCTGGA
GGATGGGCAGATCACAAACGTCAATACAAGACAGGATGGGATXTACTTCAGGTTGCTGCAATAAACACTGCTATGGCTGCTCTCACAAAA
ACAGTTGGTGTCTTTCCCAAGGAACGAGCAATTGTTGATAGAGAGCGTGCAAAAGGGTCTTATGCTCTGGGACCATATTTGCTTTCCAAG
TTGATTGCTGAGATTCCTGTTGGGGCAGCATTTCCTCTACTCTTTGGTGGCATCCTATACCCAATGGCTCGACTTCATCCTACCATTTCT
AGATTTGGGAAGTTCTGCGCAATCGTGACGGTGGAGTCTTTTGCTGCATCTGCTATGGGCTTGACTGTGGGAGCTATGGTTCCAACGACT
GAAGCTGCATTAGCGTTAGGCCCCTCTCTTATGACAGTTTTTATTGTCTTTGGAGGGTACTATGTCAATTCAGACAACACACCAATTATT
TTTCAGTGGATTCCTCGAGTTTCTTTAATAAGATGGGCGTTTCAGGGGCTTAGCATCAATGAATTTAGTGGCCTTCAGTTTGAGCATCAA
AAGACATCTGACATACAGTCTGGTGAACAGGTACTCGAGCGGCTATCATTTGGAAGCAGCCGAATAGGTGATACCATTATTGCTCAAAGA
GAATACTCATGTTTTGGTATTACACAACTTCCTTCTCCTGGAGAAAATAAGCCCAAGTATCAACGGCTTGAACCTCCACTGCGTCTCAAA
GATATCGAAGAAGAGCCAGAGGAAGAAGCAAAGCTTCAGCCCGTAAAGGATGATGATTTGCCTGAACCAACTCAACAAGTTGAATCTCCT
CCCTCAGATGAAGGTAAACCCGACGAGCAGCAGGAATCTTCTCCTGCTGATCCACTTGATCTGTTTACCCTTGACGXGCTTGTNAATTGC
TTNGGGAAAATGGATGATGTTGATAACGAAGATATGGACTTTTTTATTGATTTATCTCCTACAGGTGCTTATCAAAAGGAGATGCTTGXT
GCAGTAAAAGGAGCTCNTTTCTATGTGAGCTATTGA
Edits in Original Sequence 
CCGAATTCGGCACGAGGGGTGGTTGGTGGACCCTTTTCAGGTTACTTCTCAAACGTGC(5')ATGGATGcAAGCTTCTCGTGATGGACCA
ACAAACAAAGTTCGGGCAAGGATGTCAATTGCTTCAGCTTTGATATTTGGTTCTGTaTTCTGGAGGATGGGCAGATCACAAACGTCAATA
CAAGACAGGATGGGATXTACTTCAGGTTGCTGCAATAAACACTGCTATGGCTGCTCTCACAAAAACAGTTGGTGTCTTTCCCAAGGAACG
AGCAATTGTTGATAGAGAGCGTGCAAAAGGGTCTTATGCTCTGGGACCATATTTGCTTTCCAAGTTGATTGCTGAGATTCCTGTTGGGGC
AGCATTTCCTCTACTCTTTGGTGGCATCCTATACCCAATGGCTCGACTTCATCCTACCATTTCTAGATTTGGGAAGTTCTGCGCAATCGT
GACGGTGGAGTCTTTTGCTGCATCTGCTATGGGCTTGACTGTGGGAGCTATGGTTCCAACGACTGAAGCTGCATTAGCGTTAGGCCCCTC
TCTTATGACAGTTTTTATTGTCTTTGGAGGGTACTATGTCAATTCAGACAACACACCAATTATTTTTCAGTGGATTCCTCGAGTTTCTTT
AATAAGATGGGCGTTTCAGGGGCTTAGCATCAATGAATTTAGTGGCCTTCAGTTTGAGCATCAAAAGACATCTGACATACAGTCTGGTGA
ACAGGTACTCGAGCGGCTATCATTTGGAAGCAGCCGAATAGGTGATACCATTATTGCTCAAAGtAGAATACTCATGTTTTGGTATTACAC
AACTTaCCTTCTCCTGGAGAAAATAAGCCCAAGTATCAACGGCTTGAACCTCCACTGCGTCTCAAAGATATCGAAGAAGAGCCAGAGGAA
GAAGCAAAGCTTCAGCCCGTAAAGGATGATGATTTGCCTGAACCAACTCAACAAGTTGAATCTCCTCCCTCAGATGAAGGTAAACCCGAC
GAGCAGCAGGAATCTTCTCCTGCTGATCCACTTGATCTGTTTACCCTTGACGXGCTTGTNAATTGCTTNGGGAAAATGGATGATGTTGAT
AACGAAGATATGcGACTTTTTTATTGATTTATCTCCTACAGGTGCTTATCAAAAGGAGATGCTTGXTGCAGTAAAAGGAGCTCNTTTCTA
TGTGAGCTATTGA(3')GCTAATTCTACTAATATGCAGTAAATTCCTCCCCTTCCTGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan