Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U322313

Score 
364
Direction 
Forward
Predicted Peptide Sequence 
EGGCWGPGTKMEEKVKILAFIGAGALLGSAATIAISKLLSDPLPINNQSVGKGYTSEAVQSNGLSGSKCNGLATPNPLTDEVVSEQLPGN
TSFFFFLIILRQEDFNNEERSTRKKTICDQANXMAIAAIENCFPVSSKIVQVKYPWKNTYIYCIEDRKNSSXIIHDVAEKPCHVLAFCSN
GLHDXDIQNIAFLRIETEITICLVRPFSFFSAPS
Predicted Coding Sequence 
XXTGAAGGTGGCTGCTGGGGTCCGGGAACGAAGATGGAAGAGAAAGTTAAGATTTTAGCATTCATCGGAGCTGGAGCTCTATTGGGTTCT
GCTGCTACAATTGCTATCTCAAAGCTTCTTTCCGATCCACTGCCAATAAACAACCAAAGTGTTGGAAAAGGGTATACAAGTGAGGCAGTA
CAATCAAATGGGCTTTCTGGATCCAAATGTAATGGATTGGCTACTCCAAACCCGTTGACTGATGAAGTAGTTTCTGAACAACTGCCAGGT
AATACTTCTTTCTTTTTCTTTTTAATTATATTAAGGCAAGAAGATTTTAATAATGAGGAAAGGAGTACAAGGAAGAAAACTATCTGTGAC
CAAGCCAATAAXATGGCAATTGCAGCAATAGAGAACTGTTTTCCAGTCTCTTCTAAGATTGTTCAAGTGAAATATCCTTGGAAAAATACC
TATATCTACTGCATAGAGGATAGGAAGAATAGCTCTAXTATCATACATGATGTAGCAGAGAAACCTTGCCATGTTTTGGCATTTTGCTCT
AATGGGCTTCATGATGXTGACATTCAAAATATAGCCTTCCTCAGAATTGAAACAGAGATCACTATTTGCTTGGTGCGTCCATTTTCTTTC
TTTTCCGCACCATCX
Edits in Original Sequence 
(5')XXTGAAGGTGGCTGCTGGGGTCCGGGAACGAAGATGGAAGAGAAAGTTAAGATTTTAGCATTCATCGGAGCTGGAGCTCTATTGGG
TTCTGCTGCTACAATTGCTATCTCAAAGCTTCTTTCCGATCCACTGCCAATAAACAACCAAAGTGTTGGAAAAGGGTATACAAGTGAGGC
AGTACAATCAAATGGGCTTTCTGGATCCAAATGTAATGGATTGGCTACTCCAAACCCGTTGACTGATGAAGTAGTTTCTGAACAACTGaC
CAGGTAATACTTCTTTCTTTTTCTTTTTAATTATATTAAGGCAAGAAGATTTTAATAATGAGGAAAGGAGTACAAGGAAGAAAACTATCT
GTGACCAAGCCAATAAXATGGCAATTGCAGCAATAGAGAACTGTTTTCCAGTCTCTTCTAAGATTGTTCAAGTGAAATATCCTTGGAAAA
ATACCTATATCTACTGCATAGAGGATAGGAAGAATAGCTCTAXTATCATACATGATGTAGCgAGAGAAACCTTGCCATGTTTTGGCATTT
TGCTCTAATGGGCTTCATGATGXTGACATTCAAAATATAGCCTTCCTCAGAATTGAAACAGAGATCACTATTTGCTTGGTGCGTCCATTT
TCTTTCTTTTCCGCACCATCX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan