ESTScan Details for Unigene SGN-U322321

Score 
1189
Direction 
Forward
Predicted Peptide Sequence 
MDFSSIFCCVKGSDRKGQAKKQPTWRVFSLKELHSATNNFNYDNKLGEGGFGSVYWGQLWDGSQIAVKRLKVWSNKAEMEFAVEVEILAR
VRHKNLQVYAVTXAEGQERLIVYDYMPNLSLLSHLHGQHSAESLLDWKRRMNVAIGSAEGIAYLHHHATPHIIHRDIKASNVLLDSDFQA
QVADFGFAKFIPDGATHVTTRVKGTLGYLAPEYAMLGKASESCDVYSFGILLLELASGKKPIEKVNLTVKRTITDWALPLVCEGKLSELA
DPRLSGNYVEEEFKRVVLVALVCAQNRPEKRPTMLDVIELLKGEAKEKFTALENDDMFKIPPVVDDDVLSGTEGNADSTASEEKEPKPEI
EKVEVQA
Predicted Coding Sequence 
ATGGACTTTTCGTCTATATTTTGCTGTGTCAAGGGTTCAGATCGAAAGGGGCAAGCGAAGAAGCAGCCAACATGGAGGGTTTTTTCTCTG
AAGGAGTTGCACTCTGCTACGAATAATTTTAACTATGATAACAAGCTTGGAGAAGGTGGTTTTGGAAGTGTTTACTGGGGGCAGCTCTGG
GATGGATCTCAGATAGCAGTCAAAAGGCTAAAGGTGTGGAGCAACAAAGCTGAGATGGAATTTGCTGTTGAAGTTGAAATTCTGGCTAGA
GTACGACACAAAAATCTTCAAGTTTACGCGGTTACTGXTGCAGAAGGCCAGGAACGTCTGATCGTATATGACTACATGCCTAATTTAAGC
TTGCTTTCTCATCTTCACGGCCAGCATTCTGCTGAAAGCCTTCTTGATTGGAAACGCCGAATGAATGTTGCAATTGGATCAGCTGAGGGA
ATTGCCTATCTGCACCACCATGCAACCCCGCATATCATCCACAGAGACATCAAAGCAAGCAACGTGCTGCTCGATTCTGATTTCCAAGCC
CAAGTTGCTGATTTTGGATTTGCAAAGTTCATCCCAGATGGTGCAACACATGTAACCACTAGAGTAAAAGGCACTCTAGGCTATCTTGCA
CCAGAATATGCAATGTTAGGGAAGGCATCGGAGAGCTGTGATGTTTACAGCTTTGGTATTCTTTTGCTAGAGCTTGCTAGTGGCAAGAAA
CCAATTGAGAAGGTCAATCTAACTGTGAAACGCACAATCACTGATTGGGCACTACCACTTGTGTGTGAAGGGAAGTTGAGTGAACTTGCA
GACCCAAGGTTGAGTGGGAACTACGTGGAGGAAGAATTCAAAAGAGTGGTTCTTGTTGCTCTCGTTTGTGCTCAAAATCGACCTGAGAAG
AGACCAACAATGCTTGACGTTATCGAGCTACTGAAAGGAGAAGCAAAAGAGAAATTCACAGCTTTGGAAAATGATGATATGTTCAAGATT
CCTCCAGTAGTGGATGATGATGTTTTGTCAGGAACAGAAGGCAATGCAGACTCTACTGCTTCAGAGGAAAAAGAACCAAAACCAGAAATT
GAAAAGGTAGAGGTACAAGCTTAA
Edits in Original Sequence 
CTTTGCTGTAACGGAAATGGGGGAGCTTTATTCTTTTTGAGCAGAGAAAAACAGTCAGATAAAGTGATTGCTGAGTGGAGTTTACGGCTT
TTTCTTCTTTTCTGCTATGGGGTTCTGAAAGATTGATTCTTGATCGACTTATTTGATATACTCTTCTGTTAAGAAAGAGAAAGTTGAGTT
TTTTGCTGTTTCAATATTCAAAATTCAAAAGCT
(5')ATGGACTTTTCGTCTATATTTTGCTGTGTCAAGGGTTCAGATCGAAAGGGGCA
AGCGAAGAAGCAGCCAACATGGAGGGTTTTTTCTCTGAAGGAGTTGCACTCTGCTACGAATAATTTTAACTATGATAACAAGCTTGGAGA
AGGTGGTTTTGGAAGTGTTTACTGGGGGCAGCTCTGGGATGGATCTCAGATAGCAGTCAAAAGGCTAAAGGTGTGGAGCAACAAAGCTGA
GATGGAATTTGCTGTTGAAGTTGAAATTCTGGCTAGAGTACGACACAAAAATCTTCtAAGTTTACGCGGTTACTGXTGCAGAAGGCCAGG
AACGTCTGATCGTATATGACTACATGCCTAATTTAAGCTTGCTTTCTCATCTTCACGGCCAGCATTCTGCTGAAAGCCTTCTTGATTGGA
AACGCCGAATGAATGTTGCAATTGGATCAGCTGAGGGAATTGCCTATCTGCACCACCATGCAACCCCGCATATCATCCACAGAGACATCA
AAGCAAGCAACGTGCTGCTCGATTCTGATTTCCAAGCCCAAGTTGCTGATTTTGGATTTGCAAAGTTCATCCCAGATGGTGCAACACATG
TAACCACTAGAGTAAAAGGCACTCTAGGCTATCTTGCACCAGAATATGCAATGTTAGGGAAGGCATCGGAGAGCTGTGATGTTTACAGCT
TTGGTATTCTTTTGCTAGAGCTTGCTAGTGGCAAGAAACCAATTGAGAAGGTCAATCTAACTGTGAAACGCACAATCACTGATTGGGCAC
TACCACTTGTGTGTGAAGGGAAGTTGAGTGAACTTGCAGACCCAAGGTTGAGTGGGAACTACGTGGAGGAAGAATTCAAAAGAGTGGTTC
TTGTTGCTCTCGTTTGTGCTCAAAATCGACCTGAGAAGAGACCAACAATGCTTGACGTTATCGAGCTACTGAAAGGAGAAGCAAAAGAGA
AATTCACAGCTTTGGAAAATGATGATATGTTCAAGATTCCTCCAGTAGTGGATGATGATGTTTTGTCAGGAACAGAAGGCAATGCAGACT
CTACTGCTTCAGAGGAAAAAGAACCAAAACCAGAAATTGAAAAGGTAGAGGTACAAGCTTAA(3')GAGAATGTGGGTAATTGATTGTGG
CTTGTTCATATTGAATTTGTGTAGGACTTAATGTATTTTTTGGAGAAGAAATACTGATAATCATTACTTGGAACAACAGGTACTTTTTTT
TTTTTTTTTTTTGAATTGGAAGTATCATTTCATTGGGTTGTGCAGGAATGGATGTTATTCTCGTCTTTCGTGTGATTTTCTCGTGTAATA
TGTTGAACACAAGAAATGAAAACTGGTTATATGCTGAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan