ESTScan Details for Unigene SGN-U322414

Score 
1144
Direction 
Forward
Predicted Peptide Sequence 
MNRSIIPLLCSFLFLSASSASAFNVTKILSQYPDYTNFNDLISKTGLASEINAKSTITLLAIPNGAIGDLTSKSNDVVKKILTTHIVLDY
YDTMKLQKLKDKTSKLTTMFQESGKASNDQGFLNVTAKDNTFVFGSAVKDAQRDSRLEKSVMNQPYNISILGISQPIVTPGIDSPLSPSS
APSPKANTPKSSPPKAESPAEEEAEAPTEEDETEAPASSKDADSPSADSPPADAQAPSSSSADKLKISFGFFVVLASMVAXLLKKKLRVR
VDFSDGHSIKSFCW
Predicted Coding Sequence 
ATGAATCGTTCAATTATTCCTCTCCTTTGTTCCTTCCTCTTCCTCTCCGCCTCCTCGGCCTCCGCCTTTAATGTCACAAAAATCCTTAGC
CAATATCCCGATTACACCAATTTCAATGACCTGATATCGAAAACTGGCTTAGCTAGTGAAATCAACGCGAAGTCAACAATCACACTCTTA
GCTATCCCTAATGGTGCAATTGGTGATCTTACCTCGAAATCAAACGATGTTGTCAAGAAGATCTTGACAACACACATCGTTTTGGACTAC
TACGACACGATGAAACTTCAAAAATTGAAGGACAAGACTAGTAAATTAACAACCATGTTTCAAGAATCTGGTAAAGCATCAAATGATCAA
GGATTCTTGAATGTTACTGCTAAAGACAACACGTTCGTGTTTGGATCAGCTGTTAAGGACGCTCAACGCGATTCAAGACTAGAGAAATCC
GTCATGAATCAGCCTTACAACATCTCAATTCTTGGTATTTCTCAACCCATTGTCACACCTGGTATTGATTCACCACTTTCACCATCATCA
GCACCATCACCAAAGGCGAATACGCCTAAAAGTTCTCCACCAAAAGCAGAGTCCCCTGCTGAAGAGGAAGCAGAGGCCCCTACTGAGGAA
GATGAAACAGAGGCCCCTGCTTCCTCTAAGGATGCCGATTCGCCGTCCGCTGATTCACCACCAGCTGATGCTCAAGCACCATCATCATCA
TCTGCTGACAAATTGAAGATTTCTTTTGGTTTCTTTGTTGTTTTGGCATCAATGGTTGCAGXTCTATTGAAAAAAAAGTTAAGAGTTCGA
GTTGATTTCTCAGATGGTCACTCAATCAAGTCATTTTGCTGG
Edits in Original Sequence 
TTCTATCTAGGAAGAAACATAATTAAAAAAAATACAAAAAAAAAAAAAACTCATTTTTGCTGGTAAACAAAATTACATTTTGTTCATTAT
TCTTCCCTTTTTTTTTTTGAACTCCCTTTCTTTGGCTTGACAAAAAAATTTCGGCAAAA
(5')ATGAATCGTTCAATTATTCCTCTCCTT
TGTTCCTTCCTCTTCCTCTCCGCCTCCTCGGCCTCCGCCTTTAATGTCACAAAAATCCTTAGCCAATATCCCGATTACACCAATTTCAAT
GACCTGATATCGAAAACTGGCTTAGCTAGTGAAATCAACGCGAAGTCAACAATCACACTCTTAGCTATCCCTAATGGTGCAATTGGTGAT
CTTACCTCGAAATCAAACGATGTTGTCAAGAAGATCTTGACAACACACATCGTTTTGGACTACTACGACACGATGAAACTTCAAAAATTG
AAGGACAAGACTAGTAAATTAACAACCATGTTTCAAGAATCTGGTAAAGCATCAAATGATCAAGGATTCTTGAATGTTACTGCTAAAGAC
AACACGTTCGTGTTTGGATCAGCTGTTAAGGACGCTCAACGCGATTCAAGACTAGAGAAATCCGTCATGAATCAGCCTTACAACATCTCA
ATTCTTGGTATTTCTCAACCCATTGTCACACCTGGTATTGATTCACCACTTTCACCATCATCAGCACCATCACCAAAGGCGAATACGCCT
AAAAGTTCTCCACCAAAAGCAGAGTCCCCTGCTGAAGAGGAAGCAGAGGCCCCTACTGAGGAAGATGAAACAGAGGCCCCTGCTTCCTCT
AAGGATGCCGATTCGCCGTCCGCTGATTCACCACCAGCTGATGCTCAAGCACCATCATCATCATCTGCTGACAAATTGAAGATTTCTTTT
GGTTTCTTTGTTGTTTTGGCATCAATGGTTGCAGXTCTATTGAAAAAAAAGTTAAGAGTTCGAGTTcGATTTCTCAGATGGTCACTCAAT
CAAGTCATTTTGCTGG(3')TTGAAAAAAAATATCAGAACAATTTTCTTAGATAATAACTATTAGTTGATCATATGAGAAATCGATTCCT
ATTAAAAAGGGTTTTTGGTGTTGGATTGTAGAGAGGCACAAAATAAATTGCTGATAAATCATATTGTACACAAGATTTTTTTAAAAAAAA
AA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan