Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U322589

Score 
284
Direction 
Forward
Predicted Peptide Sequence 
GFRGSGEILKKLIFRWPESVIGKLDLVFLDAPFPAQGKSPLEGFFDPPYYEWFQANKDFTEFYNFEECLEYIEDFMLKNGPFDGVLGFSQ
VKIYSTLI
Predicted Coding Sequence 
XXTGGCTTTAGAGGAAGTGGTGAAATACTCAAGAAATTGATTTTCCGGTGGCCGGAATCCGTCATCGGAAAATTAGATTTGGTGTTTTTG
GATGCACCTTTTCCGGCTCAGGGGAAATCTCCACTTGAAGGTTTTTTTGATCCTCCTTACTATGAATGGTTTCAAGCAAATAAGGATTTT
ACAGAATTTTACAATTTTGAAGAATGCCTTGAGTATATAGAAGATTTTATGTTAAAGAATGGACCTTTTGATGGTGTTCTTGGTTTCTCA
CAGGTXAAGATTTACTCAACTCTCATTTAG
Edits in Original Sequence 
(5')XXTGGCTTTAGAGGAAGTGGTGAAATACTCAAGAAATTGATTTTCCGGTGGCCGGAATCCGTCATCGGAAAATTAGATTTGGTGTT
TTTGGATGCACCTTTTCCGGCTCAGGGGAAATCTCCACTTGAAGGTTTTTTTGATCCTCCTTACTATGAATGGTTTCAAGCAAATAAGGA
TTTTACAGAATTTTACAATTTTGAAGAATGCCTTGAGTATATAGAAGATTTTATGTTAAAGAATGGACCTTTTGATGGTGTTCTTGGTTT
CTCACAGGTXAAGATTTACTCAACTCTCATTTAG(3')GTTGTTTTTTCTTTTCTGTAAGCGTAAACGAGAAGAAATAATCTTTTACAAT
CAGTTATATTTTAAATAAGAGAACGATCTCAGAAAGATTACTTGTGTTATTTCTAAAGGATAATAACAGTTTTTAGTATAAATAGACACT
TTAACATTGCATGTACTTAGTCAATTAAATAGTGTAACGAGTTATAATTCAACGAATTTGATAAGTCTCACAAGTAGCTAAGGATGAAAT
ATGCACTACATCTTCAATTAATCGAAGATTCAATATGCTTAGTCAGATATTATAACCGATCTGTTTTTTTTCTTTTTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan