ESTScan Details for Unigene SGN-U322811

Score 
917
Direction 
Forward
Predicted Peptide Sequence 
KRGKHSVSLPLNGPSYSKTAFVVIPLTDXGSKSSMKLERLTLIPSTDSDGRLNGADDSNKVPRLPRWTRQEILVLIQGKKVTENRIRRGR
TGVVELGSPQVEPKWASVSSYCKRHGVNRGPVQCRKRWSNLAGDFKKIKEWESQIKEETDSFWVMRNDLRRDKKLPGFFDREVYDILDRG
SGDADAHEEGGLVLALGSQVLFDSGKSAASGDDALFSDFEPDETPHKPINDPPIPTPVSEQQHQPLSQVSPTQAGTSQPTTREPDIGSGH
EGRKRKKSESDADDEEARSVQHHLVRALERNGKLVSSQLEAQNMQFEQDREQRKDHVDNLVAVLTKLADALGRIADKLWAVELITMHIML
SSYTRLKFSFGLLISVGDDMFFSGFEGLVLAQEVYRRNSNKYRIWRGRCLC
Predicted Coding Sequence 
XGGAAAAGGGGAAAACACTCTGTTTCTCTTCCCCTCAACGGGCCGTCCTACTCAAAAACGGCGTTTGTCGTAATTCCGTTAACTGACGXT
GGTTCAAAAAGTAGTATGAAGCTTGAGCGATTGACCCTAATTCCGTCTACCGACTCCGACGGCCGTCTCAACGGCGCCGATGATTCTAAC
AAAGTTCCTAGGCTTCCTCGTTGGACTAGACAAGAAATTCTTGTACTGATACAGGGGAAAAAGGTTACTGAAAACCGGATCCGTCGAGGA
CGAACTGGCGTTGTTGAATTAGGTTCACCACAGGTTGAACCCAAGTGGGCTTCTGTTTCTTCCTACTGTAAAAGACATGGGGTTAACCGT
GGACCAGTTCAATGCCGAAAGAGATGGAGTAATTTGGCTGGAGATTTTAAGAAGATTAAAGAGTGGGAGTCTCAGATAAAAGAAGAAACC
GACTCCTTTTGGGTCATGAGGAATGATTTGAGAAGAGACAAAAAATTACCTGGATTTTTCGATAGAGAAGTCTATGATATTCTTGATCGT
GGAAGTGGAGATGCCGATGCCCATGAAGAAGGAGGCTTGGTTTTGGCTTTGGGCTCACAAGTCCTGTTTGATAGTGGGAAAAGTGCTGCA
TCAGGGGATGATGCCTTGTTTTCTGATTTTGAGCCTGATGAAACTCCTCATAAACCAATCAATGACCCTCCTATTCCTACTCCAGTTTCA
GAGCAACAACATCAACCACTCTCTCAAGTTTCTCCTACACAAGCAGGTACAAGCCAACCTACCACCCGAGAACCTGATATAGGAAGTGGT
CATGAAGGAAGGAAAAGAAAGAAAAGCGAGTCAGATGCAGATGATGAAGAAGCAAGGAGTGTGCAACATCATTTAGTGAGAGCATTGGAG
AGGAATGGGAAACTGGTGAGCTCCCAACTTGAAGCTCAGAATATGCAGTTTGAACAGGATAGGGAGCAAAGGAAGGACCATGTTGATAAC
TTAGTAGCAGTACTTACGAAGCTTGCAGATGCTTTGGGAAGAATTGCAGATAAGTTATGGGCTGTTGAGTTAATTACAATGCATATCATG
TTGTCTTCATACACAAGGCTGAAGTTCAGTTTTGGTTTGTTAATTAGTGTTGGAGATGACATGTTCTTCTCAGGTTTTGAAGGGTTAGTG
TTGGCACAAGAGGTGTACAGAAGAAATAGTAATAAATACAGAATTTGGAGGGGCCGGTGTCTTTGTTAA
Edits in Original Sequence 
(5')XGGAAAAGGGGAAAACACTCTGTTTCTCTTCCCCTCAACGGGCCGTCCTACTCAAAAACGGCGTTTGTCGTAATTCCGTTAACTGA
CGXTGGTTCAAAAAGTAGTATGAAGCTTGAGCGATTGACCCTAATTCCGTCTACCGACTCCGACGGCCGTCTCAACGGCGCCGATGATTC
TAACAAAGTTCCTAGGCTTCCTCGTTGGACTAGACAAGAAATTCTTGTACTGATACAGGGGAAAAAGGTTACTGAAAACCGGATCCGTCG
AGGACGAACTGGCGTTGTTGAATTAGGTTCACCACAGGTTGAACCCAAGTGGGCTTCTGTTTCTTCCTACTGTAAAAGACATGGGGTTAA
CCGTGGACCAGTTCAATGCCGAAAGAGATGGAGTAATTTGGCTGGAGATTTTAAGAAGATTAAAGAGTGGGAGTCTCAGATAAAAGAAGA
AACCGACTCCTTTTGGGTCATGAGGAATGATTTGAGAAGAGACAAAAAATTACCTGGATTTTTCGATAGAGAAGTCTATGATATTCTTGA
TCGTGGAAGTGGAGATGCCGATGCCCATGAAGAAGGAGGCTTGGTTTTGGCTTTGGGCTCACAAGTCCTGTTTGATAGTGGGAAAAGTGC
TGCATCAGGGGATGATGCCTTGTTTTCTGATTTTGAGCCTGATGAAACTCCTCATAAACCAATCAATGACCCTCCTATTCCTACTCCAGT
TTCAGAGCAACAACATCAACCACTCTCTCAAGTTTCTCCTACACAAGCAGGTACAAGCCAACCTACCACCCGAGAACCTGATATAGGAAG
TGGTCATGAAGGAAGGAAAAGAAAGAAAAGCGAGTCAGATGCAGATGATGAAGAAGCAAGGAGTGTGCAACATCATTTAGTGAGAGCATT
GGAGAGGAATGGGAAACTGGTGAGCTCCCAACTTGAAGCTCAGAATATGCAGTTTGAACAGGATAGGGAGCAAAGGAAGGACCATGTTGA
TAACTTAGTAGCAGTACTTACGAAGCTTGCAGATGCTTTGGGAAGAATTGCAGATAAGTTATaGGGCTGTTGAGTTAATTACAATGCATA
TCATGTTGTCTTCATACACAAGGCTGAAGTTCAGTTTTGGTTTGTTAATTAGTaGTTGGAGATGACATGTTCTTCTCAGGTTTTGAAGGG
TTAGTGTTGGCACAAGAGGTGTACAGAAGAAATAGTAATAAATACAGAATTTGGAGGGGCCGGTGTCTTTGTTAA(3')TTCCTGTTTAT
ATACACAAATATCTCTTGTTTTGTCACAATTGTCAGGCAGGTAGGAAGAATCCTTTTGTTTATGAGCGACCTTAATTCTTATCTCACTAC
TTGGGGATTGCTTTCTCGGTTTGGAGGCAAATTGTATACAAATCATAATATCTCGATTCTAGTTGTCATTGTATTACTATTATGTCAGAA
TTTCCTTTAATCGATGGCATCTAATTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan