Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U322892

Score 
261
Direction 
Forward
Predicted Peptide Sequence 
EILENSKISKLKLXAEAEAIHLLSEGQAEGKLKILKGRSYQLRTTHGQGAILEAGEGRNTVELVKSASEKHLDLLRPSARYYSVSKGQAG
DAEDREKGKYTLIRDVEDLQTGFYDKPLPCFGCGIGWFSFLLGFLCPLMWYYATILYFGNYYRKDPRERAGLAASAIAAMVFSVXLAYYS
SNSLLVASAMQSFILI
Predicted Coding Sequence 
XTAGAAATACTTGAAAATTCTAAAATCTCAAAGCTTAAGCTTAXAGCAGAAGCAGAAGCAATTCATTTGTTATCTGAAGGTCAAGCAGAG
GGGAAACTCAAAATACTTAAAGGTAGAAGCTATCAGCTAAGAACTACACATGGACAAGGGGCTATTCTTGAAGCTGGAGAGGGAAGAAAT
ACCGTTGAACTTGTGAAATCAGCCTCTGAAAAACATCTTGACCTTTTGAGGCCATCAGCTCGATATTATTCAGTGTCGAAAGGGCAAGCT
GGTGATGCAGAAGACCGTGAGAAGGGAAAGTATACCTTGATTAGAGATGTAGAGGACCTTCAAACAGGGTTCTATGATAAACCTCTTCCT
TGCTTTGGTTGCGGAATCGGATGGTTTTCATTTCTTCTGGGATTTCTATGCCCGTTGATGTGGTATTATGCCACGATACTTTATTTCGGA
AACTACTACCGTAAGGATCCTAGAGAACGTGCTGGGCTTGCTGCATCTGCTATTGCTGCAATGGTGTTTTCTGTTGXTCTTGCTTATTAT
AGCAGCAACTCTCTTCTTGTAGCTTCTGCGATGCAAAGTTTCATACTAATATGA
Edits in Original Sequence 
(5')XTAGAAATACTTGAAAATTCTAAAATCTCAAAGCTTAAGCTTAXAGCAGAAGCAGAAGCAATTCATTTGTTATCTGAAGGTCAAGC
AGAGGGGAtAACTCAAAATACTTAAAGGTAGAAGCTATCAGCTAAGAACTACACATGGACAAgGGGGCTATTCTTGAAGCTGGAGAGGGA
AGAAATACCGTTGAACTTGTGAAATCAGCCTCTGAAAAACATCTTGACCTTTTGAGGCCATCAGCTCGATATTATTCAGTGTCGAAAGGG
CAAGCTGGTGATGCAGAAGACCGTGAGAAGGGAAAGTATACCTTGATTAGAGATGTAGAGGACCTTCAAACAGGGTTCTATGATAAACCT
CTTCCTTGCTTTGGTTGCGGAATCGGATGGTTTTCATTTCTTCTGGGATTTCTATGCCCGTTGATGTGGTATTATGCCACGATACTTTAT
TTCGGAAACTACTACCGTAAGGATCCTAGAGAACGTGCTGGGCTTGCTGCATCTGCTATTGCTGCAATGGTGTTTTCTGTTGXTCTTGCT
TATTATAGCAGCAACTCTCTTCTTGTAGCTTCTGCGATGCAAAGTTTCATACTAATATGA(3')TCAATGTTACTTGTTCTGTAGTCAAG
TCAAATGCCTCCAAACTCTCCAATTGTAAATGTTGTGACGAATGAAAAAAAAAAAGATTCTTATACAGAACTANNAAAAAAAAAAAAAAA
CACACAAAAAAACCCCCGGGGGGGGGGC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan