ESTScan Details for Unigene SGN-U322947

Score 
752
Direction 
Forward
Predicted Peptide Sequence 
PSIFSGYIFVPQALRSENGKRSTSLVVSTNXPAPVPPFLEDHHRQFPILTGDSERWMFPAITLVSKXRDVSYRPPGTKIDLLSQVNLSIP
EKSFGLIFGRSGSGKTTLLQLIAGLSKPTSGSIYVQRYGDDDQQIKSPEPLQPERVGIVFQFPERYFVADTVLDEVTFGWPRQKGGLQLR
ELLASRLQKAIMSVGLTGISLDKDPHSLSGGYKRRLALAIQLVQTPDLLILDEPLAGLDWKARADVAKLLKDLKKELTLLVVSHDLKELA
SLVDQSWRMEMGGALKKEPLPI
Predicted Coding Sequence 
XGCCCCTCAATTTTCTCTGGTTACATTTTTGTTCCGCAGGCTCTGAGATCAGAAAATGGGAAGCGTTCCACTTCCCTCGTCGTCTCTACT
AATXTTCCAGCTCCAGTTCCTCCATTTTTGGAAGATCATCATCGACAATTTCCTATCCTCACCGGCGATTCAGAAAGGTGGATGTTTCCT
GCGATTACTCTTGTTTCGAAAXTAAGGGATGTCTCTTATCGACCTCCAGGAACCAAGATCGATCTACTGAGTCAAGTCAACCTTTCCATC
CCTGAGAAAAGTTTTGGCTTGATATTTGGACGGAGTGGCAGTGGAAAAACTACTTTATTGCAGCTGATTGCAGGGTTAAGCAAACCAACA
TCAGGTTCAATATATGTGCAAAGATATGGTGATGATGATCAACAGATTAAGTCTCCTGAACCCTTACAACCTGAAAGAGTTGGCATTGTT
TTCCAATTTCCTGAGAGATACTTTGTTGCGGACACTGTTCTTGATGAAGTTACATTTGGGTGGCCAAGACAAAAGGGTGGCCTACAATTA
AGAGAGCTTCTTGCTTCTAGACTTCAAAAGGCCATTATGTCGGTTGGTCTAACAGGAATATCTTTGGATAAGGATCCCCATTCATTAAGC
GGTGGTTACAAACGTCGGCTAGCCCTTGCTATTCAGTTAGTTCAAACACCAGATTTATTAATATTGGATGAGCCTCTTGCTGGTCTTGAT
TGGAAGGCTCGTGCAGATGTGGCAAAATTGTTAAAAGATCTGAAGAAGGAGCTAACTTTACTTGTTGTCAGCCATGACCTCAAGGAGTTG
GCATCTTTGGTAGATCAATCCTGGAGGATGGAAATGGGAGGAGCACTTAAAAAAGAGCCTCTACCCATTTAA
Edits in Original Sequence 
(5')XGCCCCTCAATTTTCTCTGGTTACATTTTTGTTCCGCAGGCTCTGAGATCAGAAAATGGGAAGCGTTCCACTTCCCTCGTCGTCTC
TACTAATXTTCCAGCTCCAGTTCCTCCATTTTTGGAAGATCATCATCGACAATTTCCTATCCTCACCGGCGATTCAGAAAGGTGGATGTT
TCCTGCGATTACTCTTGTTTCGAAAXTAAGGGATGTCTCTTATCGACCTCCAGGAACCAAGATCGATCTACTGAGTCAAGTCAACCTTTC
CATCCCTGAGAAAAGTTTTGGCTTGATATTTGGACGGAGTGGCAGTGGAAAAACTACTTTATTGCAGCTGATTGCAGGGTTAAGCAAACC
AACATCAGGTTCAATATATGTGCAAAGATATGGTGATGATGATCAACAGATTAAGTCTCCTGAACCCTTACAACCTGAAAGAGTTGGCAT
TGTTTTCCAATTTCCTGAGAGATACTTTGTTGCGGACACTGTTCTTGATGAAGTTACATTTGGGTGGCCAAGACAAAAGGGTGGCCTACA
ATTAAGAGAGCTTCTTGCTTCTAGACTTCAAAAGGCCATTATGTCGGTTGGTCTAACAGGAATATCTTTGGATAAGGATCCCCATTCATT
AAGCGGTGGTTACAAACGTCGGCTAGCCCTTGCTATTCAGTTAGTTCAAACACCAGATTTATTAATATTGGATGAGCCTCTTGCTGGTCT
TGATTGGAAGGCTCGTGCAGATGTGGCAAAATTGTTAAAAGATCTGAAGAAGGAGCTAACTTTACTTGTTGTCAGCCATGACCTCAAGGA
GTTGGCATCTTTGGTAGATCAATCCTGGAGGATGGAAATGGGAGGAGCACTTAAAAAAGAGCCTCTACCCATTTAA(3')TGCACTGAAC
TTATAATGTTCCCAACAATCATTTTCTGATGTAATATATGAGGTTTTTATGAGCCTTGAATTGCATACAATTCTTGGAAAGGTGCTCAAG
GTTATTGATTTTGCTTCAATCCCTGACCATCGAGGTCTTCACATTTCATGTAACCTCTGTAATGTAATTAACAGTTTCTGTAATGAGTTT
TGAGATGGTTTCTAATTTTCTGTACACTTAGTTCGCCGTTTAAACCCTCATTAAAGTTTGATGGGTCTGCAGCATTTCTTTGTCCTTGTC
TCTCACCAAAAGTTTTGAATGTTGATTGGAATTTTGTTCAAAATATGTATAGTAGTATGCATGTATTGGTAAATTAAATTACACTGTTGA
CATATATGAATAGTAGCTTTTCTAGTTGTGTTAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan