ESTScan Details for Unigene SGN-U322957

Score 
708
Direction 
Forward
Predicted Peptide Sequence 
MWRNYGASADSFYQVRPECADDVPETKFRIKVGKTLSSRRWHAAFTPEGYLDIGKILGRVCRGGIHPSIRGEVWEFLLGCYDSKSTFEEE
SNYDNVGGVQYAALKEECRGMFPLIGSGRFISAPVITEDGDPILDPIVLQELNAAKEPTSAGQVGPSDGFELVKEHDKKXNPVETLITPD
GLDVIRTDRTLVFYEKQENLSKLWDILAVYAWFDKEVSYCQGMSDLCSPMIILLDDEADAFWCFERMMKRLRKNFTATGNSVGVEAQLTY
LASITQVIDPKL
Predicted Coding Sequence 
ATGTGGAGGAACTATGGAGCTTCTGCTGATTCATTTTATCAGGTCCGTCCTGAATGTGCTGATGATGTTCCTGAAACCAAGTTTAGAATC
AAGGTTGGGAAAACTTTAAGTTCAAGAAGATGGCATGCTGCATTTACCCCCGAAGGTTATCTTGATATAGGCAAAATACTTGGTCGAGTT
TGTCGTGGGGGAATCCATCCATCAATTAGAGGTGAAGTTTGGGAGTTCTTACTGGGCTGTTATGATTCAAAGAGCACATTTGAGGAAGAG
AGCAATTACGACAACGTCGGAGGXGTACAGTATGCAGCATTGAAAGAAGAATGTCGTGGGATGTTTCCCTTAATTGGAAGTGGTCGGTTT
ATTTCTGCACCTGTAATCACTGAAGATGGTGACCCTATTCTAGATCCTATAGTTCTTCAAGAGTTAAATGCGGCAAAAGAACCAACTTCA
GCTGGTCAAGTTGGTCCATCTGATGGTTTTGAATTGGTGAAGGAGCATGACAAAAAAGXTAATCCAGTGGAAACTCTCATTACACCAGAT
GGATTGGATGTGATTCGTACTGACCGGACCCTTGTCTTTTATGAGAAACAAGAGAATCTATCAAAGCTTTGGGATATTTTGGCTGTTTAT
GCTTGGTTTGACAAAGAAGTTAGTTATTGTCAAGGAATGAGTGATCTTTGTTCTCCCATGATTATTCTACTTGATGATGAAGCAGATGCA
TTTTGGTGCTTTGAACGTATGATGAAGAGACTGAGAAAAAATTTCACAGCTACTGGGAACTCTGTTGGAGTGGAGGCGCAGCTAACTTAT
CTAGCATCAATAACTCAAGTTATCGATCCCAAACTX
Edits in Original Sequence 
CTTGTTGTTGAAATTCTTGATCAAAGTTGTTGGTATTGAATTTTAGATTTTTGAGGAGTTTCCAAAGTAACAAAGTTTGAAGC(5')ATG
TGGAGGAACTATGGAGCTTCTGCTGATTCATTTTATCAGGTCCGTCCTGAATGTGCTGATGATGTTCCTGAAACCAAGTTTAGAATCAAG
GTTGGGAAAACTTTAAGTTCAAGAAGATGGCATGCTGCATTTACCCCCGAAGGTTATCTTGATATAGGCAAAATACTTGGTCGAGTTTGT
CGTGGGGGAATCCATCCATCAATTAGAGGTGAAGTTTGGGAGTTCTTACTGGGCTGTTATGATTCAAAGAGCACATTTGAGGAAcGAGAG
CAATTACGACAACGTCGGAGGXGTACAGTATGCAGCATTGAAAGAAGAATGTCGTGGGATGTTTCCCTTAATTGGAAGTGGTCGGTTTAT
TTCTGCACCTGTAATCACTGAAGATGGTGACCCTATTCTAGATCCTATAGTTCTTCAAGAGTTAAATGCGGCAAAAGAACCAACTTCAGC
TGGTCAAGTTGGTCCATCTGATGGTTTTGAATTGGTGAAGGAGCATGACAAAAAAGXTAATCCAGTGGAAACTCTCATTACACCAGATaG
GATTGGATGTGATTCGTACTGACCGGACCCTTGTCTTTTATGAGAAACAAGAGAATCTATCAAAGCTTTGGGATATTTTGGCTGTTTATG
CTTGGTTTGACAAAGAAGTTAGTTATTGTCAAGGAATGAGTGATCTTTGTTCTCCCATGATTATTCTACTTGATGATGAAGCAGATGCAT
TTTGGTGCTTTGAACGTATGATGAAGAGACTGAGAAAAAATTTCACAGCTACTGGGAACTCTGTTGGAGTGGAGGCGCAGCTAACTTATC
TAGCATCAATAACTCAAGTTATCGATCCCAAACTX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan