ESTScan Details for Unigene SGN-U323049

Score 
546
Direction 
Forward
Predicted Peptide Sequence 
WYYTISTGVNLDSWPSTEVLQLYNSAEENMERGMQMWEEAEEQRLNELSSTNKLQKMKSENLFKGISADEASEQAANMMSQINLLWGTML
YERSLMEFKLGLPLWQESLEVAVEKFELAGASPTDIAVMIKNHCSNSTATEGLGFNIDEIVQAWNEMYEAKRWERGVPSFRLEPLLRRRV
SKLYHALELAXSSGYGVRGIKKKLTITVVVALSLRYARWEGIVCASAVNTGFGIWTLWHYHTKDCITCFRSIAFYSITKELKKREVFISF
PLYGDEEAETCFSLFLPCRCLAQCCAAGSSKPVAESVYVVFSYSPFGSWKGPKGILFL
Predicted Coding Sequence 
TGGTATTATACGATTAGCACTGGTGTCAATCTGGATTCTTGGCCTTCTACTGAGGTTCTGCAGCTTTACAACAGTGCTGAGGAAAATATG
GAAAGAGGTATGCAGATGTGGGAGGAGGCAGAGGAACAGCGTCTGAACGAACTATCAAGTACCAACAAATTGCAGAAGATGAAGTCAGAG
AATTTGTTTAAAGGAATATCTGCAGATGAAGCTTCTGAGCAAGCTGCAAACATGATGTCTCAGATAAATTTACTATGGGGTACCATGCTA
TACGAACGATCACTTATGGAGTTCAAACTTGGGCTTCCACTCTGGCAAGAATCTTTGGAGGTTGCTGTTGAAAAATTTGAATTGGCCGGA
GCTTCTCCAACAGATATTGCTGTTATGATAAAGAATCATTGTTCCAACAGTACAGCGACAGAAGGGCTGGGATTCAATATTGACGAGATA
GTGCAGGCATGGAATGAGATGTATGAAGCAAAACGGTGGGAAAGAGGCGTCCCTTCTTTCAGGTTGGAACCGTTGCTTAGGCGGCGAGTT
TCCAAGCTGTATCATGCCCTTGAATTAGCAXTGAGTTCTGGTTATGGTGTCAGAGGAATCAAGAAGAAACTCACTATTACTGTTGTTGTT
GCACTCAGTCTACGCTATGCTCGCTGGGAAGGGATTGTTTGTGCATCAGCTGTTAATACAGGTTTTGGAATTTGGACCTTGTGGCACTAT
CATACTAAGGATTGTATTACCTGTTTTCGTTCCATCGCTTTTTACAGTATCACAAAGGAATTAAAGAAAAGAGAAGTTTTTATCTCTTTT
CCTTTATATGGAGATGAAGAGGCAGAAACATGTTTTTCTTTATTTTTGCCTTGTCGTTGTCTTGCCCAGTGCTGTGCTGCAGGTTCCTCA
AAGCCAGTAGCXGAATCGGTTTATGTAGTTTTCAGTTATTCTCCTTTTGGCTCATGGAAGGGTCCTAAAGGCATTCTTTTCTTATAG
Edits in Original Sequence 
(5')TGGTATTATACGATTAGCACTGGTGTCAATCTGGATTCTTGGCCTTCTACTGAGGTTCTGCAGCTTTACAACAGTGCTGAGGAAAA
TATGGAAAGAGGTATGCAGATGTGGGAGGAGGCAGAGGAACAGCGTCTGAACGAACTATCAAGTACCAACAAATTGCAGAAGATGAAGTC
AGAGAATTTGTTTAAAGGAATATCTGCAGATGAAGCTTCTGAGCAAGCTGCAAACATGATGTCTCAGATAAATTTACTATGGGGTACCAT
GCTATACGAACGATCACTTATGGAGTTCAAACTTGGGCTTCCACTCTGGCAAGAATCTTTGGAGGTTGCTGTTGAAAAATTTGAATTGGC
CGGAGCTTCTCCAACAGATATTGCTGTTATGATAAAGAATCATTGTTCCAACAGTACAGCGACAGAAGGGCTGGGATTCAATATTGACGA
GATAGTGCAGGCATGGAATGAGATGTATGAAGCAAAACGGTGGGAAAGAGGCGTCCCTTCTTTCAGGTTGGAACCGTTGCTTAGGCGGCG
AGTTTCCAAGCTGTATCATGCCCTTGAATTAGCAXTGAGTTCTGGTTATGGTGTCAGAGGAATCAAGaAAGAAACTCACTATTACTGTTG
TTGTTGCACTCAGTCTACGCTATGCTCGCTGGGAAGGGATTGTTTGTGCATCAGCTGTTAATACAGGTTTTGGAATTTGGACCTTGTGGC
ACTATCATACTAAGGATTGTATTACCTGTTTTCGTTCCATCGCTTTTTACAGTATCACAAAGGAATTAAAGAAAAGAGAAGTTTTTATCT
CTTTTCCTTTATATGGAGATGAAGAGGCAGAAACATGTTTTTCTTTATTTTTGCCTTGTCGTTGTCTTGCCCAGTGCTGTGCTGCAGGTT
CCTCAAAGCCAGTAGCXGAATCGGTTTATGTAGTTTTCAGTTATTCTCCTTTTGGCTCATGGAAGGGTCCTAAAGGCATTCTTTTCTTAT
AG(3')GAATTTCTTTGTTAGGAGAACTTTTTGTTGTCACCAAGATTGGCTTGTAGTACTGTTTTGTGTCAGTTTAGCCTTACTGTATGT
TTTTCTTAAGAGATTTCACAATTAGCGTCCTAGATAGAGTTCTTGCATTGTATTGATGTAACATTATTGTATTGATGTAACATTATGTGA
GTTAATTATGTATTGTACTTGTTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan