ESTScan Details for Unigene SGN-U323232

Score 
781
Direction 
Forward
Predicted Peptide Sequence 
MFLVDWFYGVLASLGLWQKDAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGNIKFKAFDLGGHQIARRVWRDYYAKVDA
VVYLVDANDRERFPEAKKELDGLLSDESLTNVPFLILGNKIDIPYAASEDELRYHLGLTGVTTGKGNINLAGTNVRPIEVFMCSIVRKMG
YGEGFKWMSQSSSRRVNHDELAGKVPLXVIPIGWLGCEGGKNTENFSQSGK
Predicted Coding Sequence 
ATGTTTCTGGTGGATTGGTTCTATGGAGTGTTGGCATCACTAGGGTTGTGGCAGAAGGATGCGAAGATCTTGTTTTTAGGGCTTGATAAT
GCTGGCAAAACTACCTTGCTTCATATGTTGAAAGATGAGAGATTGGTGCAGCATCAACCTACACAGTACCCCACATCAGAGGAGTTGAGT
ATTGGGAATATCAAGTTCAAGGCTTTTGATTTAGGGGGACACCAGATTGCTAGAAGAGTCTGGAGAGACTATTATGCCAAGGTGGACGCT
GTTGTTTATCTTGTGGACGCAAATGACAGAGAGAGGTTTCCAGAGGCAAAGAAGGAATTGGATGGGCTTCTGTCAGATGAGTCGTTAACA
AATGTCCCATTTCTCATTTTGGGAAACAAGATTGATATACCATATGCTGCCTCAGAAGATGAGCTGCGTTATCACTTGGGCCTAACTGGT
GTGACCACTGGCAAGGGTAACATCAACCTTGCTGGTACCAATGTCCGTCCAATTGAGGTGTTTATGTGCAGCATTGTGCGCAAGATGGGA
TATGGTGAGGGTTTCAAGTGGATGTCGCAATCATCAAGTAGGAGAGTCAACCATGACGAACTTGCTGGCAAAGTTCCTCTTXCTGTGATC
CCAATCGGTTGGTTGGGTTGCGAGGGGGGCAAGAACACAGAGAACTTCTCCCAATCAGGAAAGTAG
Edits in Original Sequence 
ATTAGAGAGAAATTGAAAACTTTGAACGCTTTTTTCTTTCTGTTGTTTCAATCTTCTTTTTCTGGTGATTTTACAGAGGTGTTTTGTGTG
TGGTGTTGATCAATTATAAGGAAGAAATC
(5')ATGTTTCTGGTGGATTGGTTCTATGGAGTGTTGGCATCACTAGGGTTGTGGCAGAAG
GATGCGAAGATCTTGTTTTTAGGGCTTGATAATGCTGGCAAAACTACCTTGCTTCATATGTTGAAAGATGAGAGATTGGTGCAGCATCAA
CCTACACAGTACCCCACATCAGAGGAGTTGAGTATTGGGAATATCAAGTTCAAGGCTTTTGATTTAGGGGGACACCAGATTGCTAGAAGA
GTCTGGAGAGACTATTATGCCAAGGTGGACGCTGTTGTTTATCTTGTGGACGCAAATGACAGAGAGAGGTTTCCAGAGGCAAAGAAGGAA
TTGGATGGGCTTCTGTCAGATGAGTCGTTAACAAATGTCCCATTTCTCATTTTGGGAAACAAGATTGATATACCATATGCTGCCTCAGAA
GATGAGCTGCGTTATCACTTGGGCCTAACTGGTGTGACCACTGGCAAGGGTAACATCAACCTTGCTGGTACCAATGTCCGTCCAATTGAG
GTGTTTATGTGCAGCATTGTGCGCAAGATGGGATATGGTGAGGGTTTCAAGTGGATGTCGCAATaCATCAAGTAGGAGAGTCAACCATGA
CGAACTTGCTGGCAAAGTTCCTCTTXCTGTGATCCCAATCGGTTGGTTGGGTTGCGAGGGGGGCAAGAACACAGAGAACTTCTCCCAATC
AGGAAAGTAG(3')CATGTCAGGTTACATTGTATTGGATAAACGCTACAGCTTTGCACTAGCTTGTTTCTAGTTTTATCTTTACTCTTTT
CGGATAGAAAGTTTGTACAGGGAAAGGACAATAATGAAAGAAGGGCACTCCTTGTTCTTTATCCTTGCAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan