ESTScan Details for Unigene SGN-U323254

Score 
446
Direction 
Forward
Predicted Peptide Sequence 
QLLVEWTVASPTLKFLFTXSLPLAVKTCLSSSTCFLSNNSSFGTSSVGFRRSLFVVATGSSSKCEFGGLNAPLEPATPTGRLLSTLLLND
RKYFHVAVQKQLEKLANERDEAVARMNLSLGTDEAFLHRQKKLHESRCWHHLLIPTGLAEDEFPHXQSTPAEGSPSLMQSISSTIKXLRQ
LTAPATDER
Predicted Coding Sequence 
XGTCAATTGCTTGTTGAATGGACTGTGGCCTCTCCTACACTAAAATTTCTCTTCACCAAXTCTTTACCTCTTGCGGTGAAGACTTGCTTA
TCATCATCAACTTGTTTCCTTTCCAACAATTCCTCCTTCGGCACTTCTTCTGTTGGTTTTAGGAGATCCTTGTTTGTAGTGGCTACTGGT
AGTAGTAGTAAGTGTGAGTTTGGTGGCTTGAACGCGCCGTTAGAACCAGCAACGCCGACTGGGAGGTTGTTGAGCACTCTGCTACTGAAT
GATCGTAAGTATTTCCACGTTGCTGTTCAGAAACAGTTGGAGAAGTTGGCTAATGAACGGGATGAAGCTGTGGCTCGGATGAATCTGAGC
TTGGGCACTGATGAAGCTTTTCTGCACAGGCAAAAGAAGTTGCATGAATCCCGTTGCTGGCACCACCTACTAATCCCCACTGGACTTGCT
GAGGATGAATTCCCTCATXACCAGTCAACTCCTGCAGAGGGATCTCCATCCTTAATGCAATCCATCTCTTCAACAATTAAGAXGTTAAGA
CAGTTAACTGCTCCTGCCACTGATGAGAGGTAA
Edits in Original Sequence 
(5')XGTCAATTGCTTGTTGAATGGACTGTGGCCTCTCCTACACTAAAATTTCTCTTCACCAAXTCTTTACCTCTTGCGGTGAAGACTTG
CTTATCATCATCAACTTGTTTCCTTTCCAACAATTCCTCCTTCGGCACTTCTTCTGTTGGTTTTAGGAGATCCTTGTTTGTAGTGGCTAC
TGGTAGTAGTAGTAAGTGTGAGTTTGGTGGCTTGAACGCGCCGTTAGAACCAGCAACGCCGACTGGGAGGTTGTTGAGCACTCTGCTACT
GAATGATCGTAAGTATTTCCACGTTGCTGTTCAGAAACAGTTGGAGAAGTTGGCTAATGAACGGGATGAAGCTGTGGCTCGGATGAATCT
GAGCTTGGGCACTGATGAAGCTTTTCTGCACAGGCAAAAGAAGTTGCATGAATCCCGTTGCTGGCACCACCTACTAATCCCCACTGGACT
TGCTGaAGGATGAATTCCCTCATXACCAGTCAACTCCTGCAGAGGGATCTCCATCCTTAATGCAATCCATCTCTTCAACAATTAAGAXGT
TAAGACAGTTAACTGCTCCTGCCACTGATGAGAGGTAA(3')GTGCATTCAAGTGTTAAGAGTTAACAACTAGCTGTGTTTGTTGGTTAG
CAGCCAGCAGAAAAATTGTCACATTTTATAATGAGATGCTGGAGGGATGAAGAGTTGCCGATTGTGTTTGCTTTATTCCTTTTCATTTCC
TACTTGGGTTTAAGGATAATGTAGGGTGTGTTTGTATCTGTCAACCCTGTTTTTTTAAAATAATTTTCACTTATTGTTCCTACCAAGTTG
AAGCAATGATATAAAAAGAGAAGGAATTTTTAGGATTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan