ESTScan Details for Unigene SGN-U323258

Score 
734
Direction 
Forward
Predicted Peptide Sequence 
KLSISAENKKEPMATISFKFASPSKPSNPSIAPKNPTIFNXTTHSIESPAQKSLLSQISCNFSHLYQGSKAPTMSFFFHSNHFPFSGIVE
EMGQIKQLGYDKPDSFTMKIQAKLILEDINLGDSISVNGTCLTVAEFDTQKLEFSVGLAPETLRKTSLIELEQGSLVNLERALRPSTRMG
GHFVQGHVDGTGEIVELKTEGDSLWVKVKTAKEILRYIVPKGFIAVDGTSLTVVDVVDEEGCFNFMLVAYTQQNVVIPLKKVGQKVNLEV
DILGKYVERLLSSGFVDSIKSS
Predicted Coding Sequence 
XXAAAACTTAGCATTTCAGCAGAGAACAAGAAAGAGCCGATGGCGACAATTTCATTCAAATTTGCTTCTCCTTCAAAGCCCTCAAACCCT
TCGATCGCTCCCAAAAACCCTACAATTTTCAATXCTACTACCCACTCCATCGAATCCCCAGCTCAAAAGAGCCTTCTTTCTCAAATCTCC
TGCAATTTCTCCCATCTTTATCAGGGCTCTAAAGCCCCAACAATGTCGTTCTTCTTCCACTCCAATCACTTCCCTTTTTCCGGCATAGTT
GAAGAAATGGGTCAGATTAAACAACTGGGTTATGATAAACCCGACAGTTTCACCATGAAAATCCAAGCAAAACTCATTCTTGAAGATATC
AATCTCGGCGACAGCATTTCCGTCAACGGAACTTGTTTAACAGTAGCTGAGTTCGATACCCAGAAGTTGGAATTCAGTGTTGGGTTGGCG
CCGGAGACACTAAGGAAGACTTCTTTGATCGAATTAGAACAAGGGTCTCTGGTGAATCTGGAGAGGGCTTTGAGGCCTAGTACTAGAATG
GGGGGTCATTTTGTGCAGGGACATGTTGATGGGACTGGTGAGATTGTTGAGCTCAAAACTGAAGGGGATTCTTTGTGGGTGAAGGTGAAG
ACTGCTAAAGAGATTTTGAGGTACATTGTGCCAAAAGGATTCATTGCTGTGGATGGGACTAGTTTGACTGTTGTCGATGTGGTTGATGAA
GAAGGCTGTTTTAACTTCATGTTGGTGGCGTACACGCAGCAGAATGTGGTGATTCCATTGAAGAAAGTGGGGCAGAAGGTTAATCTTGAG
GTGGATATATTGGGAAAGTATGTGGAGAGGCTTCTTAGTAGTGGCTTTGTGGATTCCATCAAATCTTCATGA
Edits in Original Sequence 
(5')XXAAAACTTAGCATTTCAGCAGAGAACAAGAAAGAGCCGATGGCGACAATTTCATTCAAATTTGCTTCTCCTTCAAAGCCCTCAAA
CCCTTCGATCGCTCCCAAAAACCCTACAATTTTCAATXCTACTACCCACTCCATCGAATCCCCAGCTCAAAAGAGCCTTCTTTCTCAAAT
CTCCTGCAATTTCTCCCATCTTTATCAGGGCTCTAAAGCCCCAACAATGTCGTTCTTCTTCCACTCCAATCACTTCCCTTTTTaCCGGCA
TAGTTGAAGAAATGGGTCAGATTAAACAACTGGGTTATGATAAACCCGACAGTTTCACCATGAAAATCCAAGCAAAACTCATTCTTGAAG
ATATCAATCTCGGCGACAGCATTTCCGTCAACGGAACTTGTTTAACAGTAGCTGAGTTCGATACCCAGAAGTTGGAATTCAGTGTTGGGT
TGGCGCCGGAGACACTAAGGAAGACTTCTTTGATCGAATTAGAACAAGGGTCTCTGGTGAATCTGGAGAGGGCTTTGAGGCCTAGTACTA
GAATGGGGGGTCATTTTGTGCAGGGACATGTTGATGGGACTGGTGAGATTGTTGAGCTCAAAACTGAAGGGGATTCTTTGTGGGTGAAGG
TGAAGACTGCTAAAGAGATTTTGAGGTACATTGTGCCAAAAGGATTCATTGCTGTGGATGGGACTAGTTTGACTGTTGTCGATGTGGTTG
ATGAAGAAGGCTGTTTTAACTTCATGTTGGTGGCGTACACGCAGCAGAATGTGGTGATTCCATTGAAGAAAGTGGGGCAGAAGGTTAATC
TTGAGGTGGATATATTGGGAAAGTATGTGGAGAGGCTTCTTAGTAGTGGCTTTGTGGATTCCATCAAATCTTCATGA(3')AAAGGTTGT
TACTTTGTGCTTCATTTTATCTGTGTAACTTGCTTTGACAGAATTTTGTATCTTGAATTTCAGAGATGCTGCTTTCCCAATTGTCTCTAG
GTGTATTTCGAGATAATGTTTCAGCGAAATAGAATAAACTATATCACCGTGACTCGGGCTTGAGTCAAAGCAAAAGTATGTGAATTTTAC
ACTTAAATTTAGTAATACGGCAAAAACTTGAGCAGCAACTATGAAGGCATATTTTATGTATGATTGTACTGATGTGTTAATCTTCCTGGT
TTCACATAGTGTAAACATCAATGAAAAGCCGACGCGAATATTTAGTTAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan