ESTScan Details for Unigene SGN-U323349

Score 
344
Direction 
Forward
Predicted Peptide Sequence 
ASPESECLSGKAQKSXLFAAGDLEEAPEMYVVPPPKRPDPLSGSEDLRIYQTWKGSNIFFFQGRFIFGPDARSLALTIFLIVAPVSVFCV
FVARKLMDDFSNHLGILIMVVVIVFTFYVLVLLLLTSGRDPGIIPRNAHPPEPEGYDGTVEGGGQTPQLRLPRIKEVX
Predicted Coding Sequence 
GCTTCACCGGAATCTGAGTGTTTGTCCGGCAAGGCACAGAAGTCTXCTCTGTTTGCTGCTGGAGATCTCGAGGAAGCCCCAGAGATGTAT
GTCGTTCCTCCTCCAAAACGACCCGATCCATTGTCTGGATCCGAGGACTTGCGGATTTACCAGACATGGAAAGGAAGCAATATATTTTTC
TTCCAAGGAAGGTTCATATTTGGGCCAGACGCAAGATCCCTAGCACTGACCATATTTCTCATAGTGGCCCCTGTCTCAGTTTTCTGTGTC
TTTGTTGCAAGAAAGCTCATGGATGATTTTTCAAATCACCTGGGGATATTGATTATGGTTGTAGTCATTGTGTTCACATTCTATGTTTTA
GTTCTACTCCTTCTCACATCTGGAAGGGATCCAGGAATAATTCCTCGCAATGCACACCCTCCAGAACCAGAAGGTTATGATGGTACTGTT
GAAGGTGGTGGACAAACCCCTCAATTACGTTTGCCTCGCATTAAAGAAGTTGAX
Edits in Original Sequence 
TTTAACCTAAAAAAAAA(5')GCTTCACCGGAATCTGAGTGTTTGTCCGGCAAGGCACAGAAGTCTXCTCTGTTTGCTGCTGGAGATCTC
GAGGAAGCCCCAGAGATGTATGTCGTTCCTCCTCCAAAACGACCCGATCCATTGTCTGGATCCGAGGACTTGCGGATTTACCAGACATGG
AAAGGAAGCAATATATTTTTCTTCCAAGGAAGGTTCATATTTGGGCCAGACGCAAGATCCCTAGCACTGACCATATTTCTCATAGTGGCC
CCTGTCTCAGTTTTCTGTGTCTTTGTTGCAAGAAAGCTCATGGATGATTTTTCAAATCACCTGGGGATATTGATTATGGTTGTAGTCATT
GTGTTCACATTCTATGTTTTAGTTCTACTCCTTCTCACATCTGGAAGGGATCCAGGAATAATTCCTCGCAATGCACACCCTCCAGAACCA
GAAGGTTATGATGGTACTGTTGAAGGTGGTGGACAAACCCCTCAATTACGTTTGCCTCGCATTAAAGAAGTTGAX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan