ESTScan Details for Unigene SGN-U323353

Score 
369
Direction 
Forward
Predicted Peptide Sequence 
MTKNSKVVKKLEAPCACSGTVKFAHRDCIQKWCNEKGNTICEICLQKFEPGYTAPPPKKKAHLVDNNNNNTAAIIRGSVEADIENGRERV
ESDSESEEREMLVRSTQYYECSQAADRSASCCRTIALIFXNSAYDETFVRGDEWRSKKLSLYTSYIANF
Predicted Coding Sequence 
ATGACGAAGAATTCGAAAGTTGTXAAGAAATTAGAAGCTCCATGTGCATGTTCTGGAACTGTTAAGTTTGCACACAGGGATTGTATTCAA
AAATGGTGTAATGAAAAAGGAAACACAATTTGCGAAATTTGTTTACAGAAATTTGAACCAGGATATACGGCTCCACCTCCTAAGAAGAAG
GCCCACTTGGTTGATAATAATAATAATAATACAGCTGCAATTATTAGAGGAAGCGTAGAAGCAGATATAGAAAACGGAAGGGAAAGAGTA
GAGTCGGATTCAGAATCAGAAGAAAGAGAAATGCTGGTGAGGAGTACTCAGTATTATGAATGCTCACAAGCTGCTGATAGAAGCGCGTCT
TGCTGTCGAACTATTGCTCTTATCTTCAXCAATTCTGCTTATGATGAGACATTTGTTAGAGGTGATGAATGGAGGAGCAAAAAACTATCC
CTTTACACTTCCTACATTGCTAATTTTTAA
Edits in Original Sequence 
GAAAGGAAAGAACAAAAAAAAAAAACACTCAAAGAGATTATAATAATTATTTTTTTTACCAAAAAAAAAAGCAAAATTAAGATGGGAGAA
GTGATAATATATGTTGATGATTATGAATTTTTTTCTTCTTCAACATATTTATGTAGAATTTGCC
(5')ATGACGAAGAATTCGAAAGTTG
TXAAGAAATTAGAAGCTCCATGTGCATGTTCTGGAACTGTTAAGTTTGCACACAGGGATTGTATTCAAAAATGGTGTAATGAAAAAGGAA
ACACAATTTGCGAAATTTGTTTACAGAAATTTGAACCAGGATATACGGCTCCACCTCCTAAGAAGAAGGCCCACTTGGTTGATAATAATA
ATAATAATACAGCTGCAATTATTAGAGGAAGCGTAGAAGCAGATATAGAAAACGGAAGGGAAAGAGTAGAGTCGGATTCAGAATCAGAAG
AAAGAGAAATGCTGGTGAGGAGTACTCAGTATTATGAATGCTCACAAGCTGCTGATAGAAGCGCGTCTTGCTGTCGAACTATTGCTCTTA
TCTTCAXCAATTCTGCTTATGATGAGACATTTGTTAGAGGTGATGAATGGAGGAGCAAAAAACTATCCCTTTACACTTCCTACATTGCTA
ATTTTTAA(3')ATCAACTGGAATACTCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan