ESTScan Details for Unigene SGN-U323493

Score 
200
Direction 
Forward
Predicted Peptide Sequence 
MQASDRFNINSQLEHLQAKYVGTGHADLTRFEWAVNIQRDSYASYVGHYPMLAYFAIAENESIGRERYNFMQKMLLPCGLPPEREDDXRV
AINKGKMQGS
Predicted Coding Sequence 
ATGCAGGCTAGTGACAGGTTCAACATCAACTCCCAGCTTGAGCACTTACAAGCTAAATATGTTGGAACAGGACATGCCGATTTGACTAGA
TTTGAGTGGGCGGTAAACATTCAGCGCGATAGCTATGCGTCCTATGTTGGGCACTATCCAATGTTGGCGTATTTTGCCATTGCAGAAAAT
GAATCAATTGGAAGAGAACGTTACAATTTTATGCAGAAAATGCTTTTGCCGTGTGGCCTTCCACCTGAAAGAGAAGATGATXTAAGAGTT
GCAATAAATAAAGGCAAGATGCAAGGATCATAA
Edits in Original Sequence 
CCGCTTCACTCCCCGTCTTCGACAGTATATTTTAGTCCATATCGCGCTCTGCTTTATTCATCTCCTCTCCTTCAATCTTCTCACTGTACA
AAAAAAAAA
(5')ATGCAGGCTAGTGACAGGTTCAACATCAACTCCCAGCTTGAGCACTTACAAGCTAAATATGTTGGAACAGGACATGC
CGATTTGACTAGATTTGAGTGGGCGGTAAACATTCAGCGCGATAGCTATGCGTCCTATGTTGGGCACTATCCAATGTTGGCGTATTTTGC
CATTGCAGAAAATGAATCAATTGGAAGAGAACGTTACAATTTTATGCAGAAAATGCTTTTGCCGTGTGGCCTTCCACCTGAAAGAGAAGA
TGATXTAAGAGTTGCAATAAATAAAGGCAAGATGCAAGGATCATAA(3')ACCATAGGTTTTCGTTATCTCCAGCCTCCTTACATTCTTT
TCATATCATGTCAACCCTACATTGAAGTGTAAATGGTCAGTTTGGCAGGCCATTTATGGATACTGATTAAACCTTAGGAATTATAAATCG
TTTACATTTGATCACTCTATCTAAAACCTCTCTTTGTGATGGGTCGATTTCAATTCATCATTCTTTTTTGTTTTCTTGTATGTGTATCAA
GAGCACATATAATAATTGATCAATGGGAAAGGTTAGCATTTATTTGATGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan