ESTScan Details for Unigene SGN-U323575

Score 
655
Direction 
Forward
Predicted Peptide Sequence 
NCGGTALNPSDHRHSKAPIDPFLFRWNILSLSIWGKGFSDFTMDGNKDEALKCLKIAQTSIESGNRERALKFLNKARRLDPSLEIDDLLS
QADAFQSKSSVSSSPSSSSIPSKSGSSCTRRRVSLYTEEQVTIVREIKRKKDYYDILGLEKGSSVEDVRKSYRKLSLKVHPDKNKAPGAE
EAFKMVSKAFQCLSDAERRRTYDSVGSEEPVYTRHPTTHHHATGFRFSDDVDADEIFRNFFFGGMNPATTTHFSFGTGMGMGGXSGIKVL
IQDFDSIVACHIDLVGQLSTFIRPSLFIFEAYPYDLRLATERGVNYYVKSGKFEQEYPVNTPMRSALEEKIDNDYFSILSHNCRLEQQQL
HWGYQRQTPNCDTLKQFQAAA
Predicted Coding Sequence 
XXCAACTGCGGCGGCACAGCGTTGAATCCATCAGATCACCGCCACTCTAAGGCACCGATTGACCCTTTTCTTTTCCGTTGGAACATCTTA
TCTCTGTCGATCTGGGGAAAGGGATTCTCCGATTTTACAATGGATGGTAACAAAGATGAGGCTTTGAAATGCTTAAAAATCGCACAAACT
TCGATTGAATCTGGAAATCGAGAACGGGCGTTGAAATTCTTGAATAAAGCACGTCGATTAGATCCATCGCTTGAAATTGATGATTTATTG
TCACAAGCTGATGCTTTTCAATCTAAAAGTAGTGTATCCAGCTCTCCTTCTAGCTCATCTATACCCTCTAAGTCGGGAAGTAGTTGTACT
CGTCGGAGAGTTTCTTTGTATACGGAGGAACAAGTTACAATTGTTAGGGAGATCAAGAGGAAGAAGGATTATTACGATATCTTAGGGTTG
GAGAAAGGATCTAGTGTTGAGGATGTGAGGAAATCTTATAGGAAGTTATCTTTAAAAGTTCATCCTGATAAGAACAAGGCTCCGGGGGCG
GAAGAGGCGTTTAAGATGGTGTCTAAGGCATTTCAGTGTTTGAGTGATGCGGAGAGAAGGAGAACATATGACTCTGTTGGCTCTGAGGAG
CCTGTTTATACGAGACATCCTACTACACATCATCATGCTACTGGATTTCGATTTAGTGATGACGTTGATGCTGATGAGATATTTAGGAAT
TTCTTCTTTGGCGGTATGAATCCGGCAACTACTACTCATTTTAGCTTTGGCACTGGAATGGGAATGGGAGGAAXATCAGGGATCAAAGTC
CTTATTCAAGACTTTGATTCAATTGTTGCCTGTCATATTGATCTTGTTGGTCAACTTTCTACCTTCATCAGACCCAGTTTATTTATTTTC
GAGGCTTATCCATATGATCTTCGCCTGGCTACAGAAAGGGGTGTCAACTACTATGTCAAGTCTGGGAAATTTGAACAGGAGTATCCTGTT
AATACCCCAATGCGTTCAGCCCTTGAAGAAAAAATCGACAATGATTATTTCTCAATTCTATCTCACAACTGCAGGCTTGAGCAACAACAG
CTTCATTGGGGTTATCAACGACAAACACCAAATTGTGATACATTAAAGCAGTTCCAAGCTGCAGCTTGA
Edits in Original Sequence 
(5')XXCAACTGCGGCGGCACAGCGTTGAATCCATCAcGATCACCGCCACTCTAAGGCACCGATTGACCCTTTTCTTTTCCGTTGGAACA
TCTTaATCTCTGTCGATCTGGGGAAAGGGATTCTCCGATTTTACAATGGATGGTAACAAAGATGAGGCTTTGAAATGCTTAAAAATCGCA
CAAACTTCGATTGAATCTGGAAATCGAGAACGGGCGTTGAAATTCTTGAATAAAGCACGTCGATTAGATCCATCGCTTGAAATTGATGAT
TTATTGTCACAAGCTGATGCTTTTCAATCTAAAAGTAGTGTATCCAGCTCTCCTTCTAGCTCATCTATACCCTCTAAGTCGGGAAGTAGT
TGTACTCGTCGGAGAGTTTCTTTGTATACGGAGGAACAAGTTACAATTGTTAGGGAGATCAAGAGGAAGAAGGATTATTACGATATCTTA
GGGTTGGAGAAAGGATCTAGTGTTGAGGATGTGAGGAAATCTTATAGGAAGTTATCTTTAAAAGTTCATCCTGATAAGAACAAGGCTCCG
GGGGCGGAAGAGGCGTTTAAGATGGTGTCTAAGGCATTTCAGTGTTTGAGTGATGCGGAGAGAAGGAGAACATATGACTCTGTTGGCTCT
GAGGAGCCTGTTTATACGAGACATCCTACTACACATCATCATGCTACTGGATTTCGATTTAGTGATGACGTTGATGCTGATGAGATATTT
AGGAATTTCTTCTTTGGCGGTATGAATCCGGCAACTACTACTCATTTTAGCTTTGGCACTGGAATGGGAATGGGAGGAAXATCAGGGATC
AAAGTCCTTATTCAAGACTTTGATTCAATTGTTGCCTGTCATATTGATCTTGTTGGTCAACTTTCTACCTTCATCAGACCCAGTTTATTT
ATTTTCGAGGtCTTATCCATATGATCTTCGCCTGGCTACAGAAAGGGGTGTCAACTACTATGTCAAGTCTGGGAAATTTGAACAGGAGTA
TCCTGTTAATACCCCAATGCGTTCAGCCCTTGAAGAAAAAATCGACAATGATTATTTCTCAATTCTATCTCACAACTGCAGGCTTGAGCA
ACAACAGCTTCATTGGGGTTATCAACGACAAACACCAAATTGTGATACATTAAAGCAGTTCCAAGCTGCAGCTTGA(3')TTTACTATGA
AAGGGTGCTGTTTCCTCCTCGTGATATCTTACTCCCAAAATAAATTTAGTTTTGGATTTTAGATTGACAATCATATGCAGTTTGGTCCCT
TTATTTAAATCCTATATATTCATAGATAACTTAGTGAACTTGCCAATCTTGTTTGCATTGTTTGATAATTTCTGTGTTAAATGCAGAACA
TATATGTCATATTCTGTTCTGAACTCTACTGGATAGTAATTCATCATTCAGACCACAGGAGCTTCGATTGTTGTATTAAATTACTGCTAC
AATCATGATTGGAGATCCACTTCTTCTTTTAATTGGATAAATAAATATGATTGAAGGTTGAGTTANAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan