ESTScan Details for Unigene SGN-U323769

Score 
172
Direction 
Forward
Predicted Peptide Sequence 
MGIWSNLVVLLVIFPFCTSDPNDEMCLTHLSQSLQDPLKNLQNWTKSSFAKPCDGFTSYLQGATCNNGRIYKLSLSNLSLKGTISPYLSN
CTNLQALDLSSNAISGPIPLELQFLVNLAVLNLSANQLSGPIPEQLAICAYLNVIDLHDNQLNGLIPQQLGLLVRLSVFDVSNNRLSGPY
QRHWVTGAETCPDSMPVRLMGXKDLYGYP
Predicted Coding Sequence 
ATGGGTATTTGGAGCAACCTAGTTGTGCTCCTCGTTATTTTCCCTTTTTGTACATCAGATCCAAACGATGAGATGTGCTTGACTCATCTC
AGTCAATCTTTACAAGACCCTCTGAAGAATCTTCAAAACTGGACTAAATCCTCTTTCGCTAAACCTTGTGATGGGTTCACTTCATATCTA
CAAGGGGCAACTTGTAACAATGGCCGAATCTACAAATTATCCCTTTCCAATCTCTCGCTTAAAGGTACCATTTCTCCTTATCTCTCTAAT
TGCACCAATCTACAAGCTCTGGACCTCTCCTCCAACGCAATATCCGGCCCAATACCTCTAGAACTCCAATTCCTAGTCAATCTGGCTGTT
CTCAACCTCTCAGCTAATCAACTTTCAGGCCCAATTCCTGAACAGCTCGCCATTTGCGCTTACCTCAACGTCATCGATCTTCATGATAAT
CAGCTTAATGGGCTCATCCCCCAGCAACTAGGCCTCCTTGTACGGCTATCAGTTTTCGACGTATCCAACAATAGATTATCGGGTCCATAC
CAGCGTCACTGGGTAACCGGAGCGGAAACTTGCCCCGATTCAATGCCAGTTCGTTTGATGGGAATXAAGGATCTTTACGGGTACCCA
Edits in Original Sequence 
CAAATTTCAGAAGAAGAGTAAAAAGAGAGAGCCACCACCTCCTACAATATTCTTGATTTTTCTCTCTCGTTTCTCATTTCACTTTAGCTA
A
(5')ATGGGTATTTGGAGCAACCTAGTTGTGCTCCTCGTTATTTTCCCTTTTTGTACATCAGATCCAAACGATGAGATGTGCTTGACTC
ATCTCAGTCAATCTTTACAAGACCCTCTGAAGAATCTTCAAAACTGGACTAAATCCTCTTTCGCTAAACCTTGTGATGGGTTCACTTCAT
ATCTACAAGGGGCAACTTGTAACAATGGCCGAATCTACAAATTATCCCTTTCCAATCTCTCGCTTAAAGGTACCATTTCTCCTTATCTCT
CTAATTGCACCAATCTACAAGCTCTGGACCTCTCCTCCAACGCAATATCCGGCCCAATACCTCTAGAACTCCAATTCCTAGTCAATCTGG
CTGTTCTCAACCTCTCAGCTAATCAACTTTCAGGCCCAATTCCTGAACAGCTCGCCATTTGCGCTTACCTCAACGTCATCGATCTTCATG
ATAATCAGCTTAATGGGCTCATCCCCCAGCAACTAGGCCTCCTTGTACGGCTATCAGTTTTCGACGTATCCAACAATAGATTATCGGGTC
CgATACCAGCGTCACTGGGTAACCGGAGCGGAAACTTGCCCCGATTCAATGCCAGTTCGTTTGATGGGAATXAAGGATCTTTACGGGTAC
CCA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan