ESTScan Details for Unigene SGN-U323770

Score 
172
Direction 
Forward
Predicted Peptide Sequence 
AHPPAKRPPCTGISFGGXPTKDYRVRYQRHWVTGGETCPXFNASLFEGKKDFYGYPLPPKKSNGLSVLAIVGIGLGRGFLSLGLSFTAVC
KGLRVSEQKLDAEEGKISLFMPDF
Predicted Coding Sequence 
XGGGCTCATCCCCCAGCAAAAAGGCCTCCTTGTACGGGTATCAGTTTTGGAGGTXATCCAACAAAAGATTATCGGGTTCGATACCAGCGT
CACTGGGTAACCGGAGGGGAAACTTGCCCCGAXTTCAATGCCAGTTTGTTTGAGGGGAAAAAGGATTTTTATGGGTACCCATTGCCCCCC
AAAAAGAGTAATGGGCTATCAGTTTTGGCAATTGTAGGGATCGGCCTAGGAAGGGGATTTTTGAGTTTGGGGCTAAGTTTTACTGCTGTT
TGCAAAGGGTTGAGGGTTTCTGAGCAAAAATTGGATGCTGAAGAAGGAAAAATCAGTCTTTTTATGCCTGATTTTTGA
Edits in Original Sequence 
(5')XGGGCTCATCCCCCAGCAAAAAGGCCTCCTTGTACGGGTATCAGTTTTGGAGGTXATCCAACAAAAGATTATCGGGTTCGATACCA
GCGTCACTGGGTAACCGGAGGGGAAACTTGCCCCGAXTTCAATGCCAGTTTGTTTGAGGGGAAAAAGGATTTTTATGGGTACCCATTGCC
CCCCAAAAAGAGTAATGGGCTATCAGTTTTGGCAATTGTAGGGATCGGCCTAGGAAGGGGATTTTTGAGTTTGGGGCTAAGTTTTACTGC
TGTTTGCAAAGGGTTGAGGGTTTCTGAGCAAAAATTGGATGCTGAAGAAGGAAAAATCAGTCTTTTTATGCCTGATTTTTGA(3')AGAA
ACCCAAAATCATACTTTTCAGATTACAGGTATTTTAAATTTTTTATGGGGGTGCTCTGTTTTGCCCCTTTTTTTTTTAATTTGGGTTTAA
ATTTTATTGGGGAATTAAATTCCCCCCTTTCCTAGTTTTGGGCTTTTTATTTTTTAGATCATTATTTTCATTTTGTTTAGCTTCGTTTTC
TAACATTTGACCCCAATATGTAAAGACTTGAAGAAAATTTGGAATTGGGTTTGTAGGACAAAATTACTTTTAGCCTTAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan