Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U323795

Score 
551
Direction 
Forward
Predicted Peptide Sequence 
MFKKFSTEEVSGQNQVKASVQRRIRQSIAEEYPLLEPVLEDLLPKKSPLIVAKCQNHLNLVVVNNVPLFFNIRDGPYMPTLRLLHQYPNI
MKKLQVDRGAIKFVLSGANIMCPGLTSPGGALDVEVGAETPVAIMAEGKQHALAIGFTKMSAKDIKAINKGIGVDNMHYLNDGLWKMERL
D
Predicted Coding Sequence 
ATGTTCAAGAAGTTTTCAACTGAAGAAGTGTCTGGACAAAATCAAGTCAAGGCATCTGTGCAGCGTAGAATTCGTCAAAGCATTGCAGAA
GAGTACCCACTACTAGAGCCAGTGTTGGAAGATCTGCTTCCAAAGAAGTCTCCTCTCATTGTTGCAAAATGTCAAAATCATCTGAATTTA
GTTGTGGTAAACAATGTACCCCTGTTTTTCAACATACGTGATGGACCTTATATGCCTACTTTACGTCTTCTGCATCAATATCCAAATATA
ATGAAAAAACTACAAGTTGACAGGGGCGCAATTAAATTTGTCCTCTCTGGAGCCAACATAATGTGTCCAGGTCTTACTTCTCCTGGGGGT
GCTTTGGATGTTGAAGTGGGGGCAGAAACTCCCGTGGCTATTATGGCTGAAGGGAAGCAACATGCTCTAGCTATTGGCTTTACAAAGATG
TCGGCAAAGGATATAAAGGCAATCAACAAAGGAATTGGTGTGGATAACATGCATTATCTTAATGATGGGCTCTGGAAGATGGAGCGTCTG
GATTGA
Edits in Original Sequence 
CTGTCAATAAAATGGAGAACTCAATTGCCAAATTTGGTAATTCATCGCTTAAACCCTAACCCCCCCTCTCTCTCTCGCTCATCGTCAGCC
CGTGAAA
(5')ATGTTCAAGAAGTTTTCAACTGAAGAAGTGTCTGGACAAAATCAAGTCAAGGCATCTGTGCAGCGTAGAATTCGTCAAA
GCATTGCAGAAGAGTACCCACTACTAGAGCCAGTGTTGGAAGATCTGCTTCCAAAGAAGTCTCCTCTCATTGTTGCAAAATGTCAAAATC
ATCTGAATTTAGTTGTGGTAAACAATGTACCCCTGTTTTTCAACATACGTGATGGACCTTATATGCCTACTTTACGTCTTCTGCATCAAT
ATCCAAATATAATGAAAAAACTACAAGTTGACAGGGGCGCAATTAAATTTGTCCTCTCTGGAGCCAACATAATGTGTCCAGGTCTTACTT
CTCCTGGGGGTGCTTTGGATGTTGAAGTGGGGGCAGAAACTCCCGTGGCTATTATGGCTGAAGGGAAGCAACATGCTCTAGCTATTGGCT
TTACAAAGATGTCGGCAAAGGATATAAAGGCAATCAACAAAGGAATTGGTGTGGATAACATGCATTATCTTAATGATGGGCTCTGGAAGA
TGGAGCGTCTGGATTGA(3')GCTTTAAATGGTATCTTTACTAGATGGACAATGTTTACCTGCTGCAAATAGCAAAGACTTGCTCATTTT
TATGCAGCTGTTATTTCGTTTCTCCAGATGTTAATGAGCAAGCTGAACCAAAGTTTCTTAATTTAATGAAGGGGAGCCAAGTTTTAGGGG
ATTTATACAATTTATGATTATTGTTTTGGAACTACAAATTTTCTTAATCCGCTCGATCAAAGGAACATGAGTGGTGTTTGTGTCTGAATC
TTAACTTTGGACAATCAAGATAATCAAAAGTTAAATATACAAAAAAAGGCCAATGAAATTTACAAAAAAAAAAAAAAAAAAAAAAAAAAA
AACTCGAACTAGTTCTCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan