ESTScan Details for Unigene SGN-U323986

Score 
395
Direction 
Forward
Predicted Peptide Sequence 
MKVPENDPTHSNSLLLQSLLDSIPHTQSFKGKWSLIRTKLSTLQSHLSDLSTAPINAFHNPLYNDLLQSLSVTLKDAFALSSICHSANPP
EGKLKTQNDIDSVAAKIDNHVRDLEVLVKNGVLQENGAVSTNITSKRETIRAESRNLITRLQIGTTESKNSVLDSLLGLLQEDDKNVLIA
VAQGIVPVLVRLLDSSSSPDIKEKTVTAIANISTVDSSKHVMIAESLSILNDLLGFLNL
Predicted Coding Sequence 
ATGAAAGTACCTGAAAACGATCCGACTCACTCCAATTCCCTACTCCTTCAATCTCTTCTTGATTCCATTCCCCACACCCAAAGCTTCAAA
GGCAAATGGTCTTTAATCAGAACCAAACTCTCTACCCTTCAGAGTCACCTTTCTGACCTCTCTACTGCCCCCATCAACGCTTTCCACAAT
CCACTTTACAATGACCTCCTTCAGTCGCTGTCTGTCACTCTAAAGGATGCTTTTGCTCTTTCATCCATTTGCCACAGTGCGAACCCGCCT
GAAGGTAAACTCAAGACCCAGAATGATATTGATTCCGTTGCTGCAAAAATTGATAACCATGTGAGGGATTTGGAGGTTCTTGTTAAGAAT
GGGGTTCTTCAAGAAAACGGTGCTGTTTCGACCAATATTACATCGAAGAGGGAGACTATACGGGCGGAATCGAGGAATCTGATAACACGG
CTTCAGATCGGGACGACTGAGTCGAAGAACTCGGTTTTGGATTCGTTACTTGGGTTGTTACAGGAAGATGACAAGAATGTATTGATTGCA
GTAGCTCAAGGGATTGTTCCGGTGCTTGTGCGGTTACTCGATTCCAGCTCTTCGCCGGATATCAAGGAGAAGACAGTCACCGCCATTGCT
AACATCTCTACTGTTGATTCTAGCAAGCATGTTATGATCGCTGAAAGTCTGAGTATTCTCAACGATCTTTTAGGGTTCTTGAATCTG
Edits in Original Sequence 
ACATTTTCTCTTTCTCTTTCATTTTTCCCTCTCTCTCTCTCTGCTAAAAAAGCCGCC(5')ATGAAAGTACCTGAAAACGATCCGACTCA
CTCCAATTCCCTACTCCTTCAATCTCTTCTTGATTCCATTCCCCACACCCAAAGCTTCAAAGGCAAATGGTCTTTAATCAGAACCAAACT
CTCTACCCTTCAGAGTCACCTTTCTGACCTCTCTACTGCCCCCATCAACGCTTTCCACAATCCACTTTACAATGACCTCCTTCAGTCGCT
GTCTGTCACTCTAAAGGATGCTTTTGCTCTTTCATCCATTTGCCACAGTGCGAACCCGCCTGAAGGTAAACTCAAGACCCAGAATGATAT
TGATTCCGTTGCTGCAAAAATTGATAACCATGTGAGGGATTTGGAGGTTCTTGTTAAGAATGGGGTTCTTCAAGAAAACGGTGCTGTTTC
GACCAATATTACATCGAAGAGGGAGACTATACGGGCGGAATCGAGGAATCTGATAACACGGCTTCAGATCGGGACGACTGAGTCGAAGAA
CTCGGTTTTGGATTCGTTACTTGGGTTGTTACAGGAAGATGACAAGAATGTATTGATTGCAGTAGCTCAAGGGATTGTTCCGGTGCTTGT
GCGGTTACTCGATTCCAGCTCTTCGCCGGATATCAAGGAGAAGACAGTCACCGCCATTGCTAACATCTCTACTGTTGATTCTAGCAAGCA
TGTTATGATCGCTGAAAGTCTGAGTATTCTCAACGATCTTTTAGGGTTCTTGAATCTG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan