ESTScan Details for Unigene SGN-U324029

Score 
659
Direction 
Forward
Predicted Peptide Sequence 
LDDMLLAGVSPNEYTYTTIMHGYASLGDIEKACEYFSKIKNEGLELDIYTYEALLKACCKSGRMQSALTVTKEMSAKSIPRNTFVYNILI
DGWARRGDVWEAADLMQQMRQEGVPPDIHTFTSFINACCKAGEMQRAMKAVEEMETVGIKPNLKTYTTLIHGWARASLPEKGLKCFEQMK
QSGLKPDKAVYHCLMTSLLSRAAVADQDYIITESNMFVKRWWSXGLTVDMGTAVHWSKCLRKIERTGGDITKSLQKTFPPDWSSHRTLNG
TSNDNEIEEGSDSSDDERSSFYEIKKCNNDSDFYEEALANLYQPLAAAWSQESLGV
Predicted Coding Sequence 
XTTTTAGACGATATGTTGCTTGCCGGCGTTAGTCCAAATGAGTACACATATACAACGATTATGCATGGTTATGCATCTCTTGGTGATATT
GAAAAAGCTTGTGAATATTTTTCAAAAATTAAAAATGAGGGTTTAGAGCTCGACATATATACATATGAGGCGTTACTCAAGGCATGCTGT
AAATCAGGCAGGATGCAAAGTGCTTTGACGGTGACAAAAGAAATGAGTGCCAAAAGCATCCCAAGGAATACCTTTGTTTATAACATATTA
ATTGATGGATGGGCTCGACGAGGTGATGTCTGGGAGGCTGCTGACCTGATGCAACAGATGAGACAAGAAGGGGTTCCACCTGACATCCAT
ACATTCACGTCATTCATAAATGCTTGTTGTAAAGCTGGAGAAATGCAAAGAGCAATGAAAGCAGTTGAAGAGATGGAAACTGTTGGGATC
AAACCTAACTTAAAGACCTATACCACTCTTATACATGGTTGGGCACGGGCTTCTCTTCCCGAGAAGGGTTTGAAATGTTTTGAACAGATG
AAGCAGTCTGGTTTGAAACCTGACAAAGCTGTATACCACTGTTTAATGACATCATTGTTGTCAAGGGCGGCAGTTGCTGATCAAGATTAC
ATTATAACAGAATCCAACATGTTTGTGAAGAGATGGTGGAGTXCTGGATTGACTGTTGATATGGGAACTGCAGTTCATTGGTCCAAGTGC
TTGAGAAAAATTGAGAGGACTGGTGGTGATATAACAAAATCCCTTCAAAAGACCTTCCCACCTGATTGGAGTTCTCACCGAACTCTTAAT
GGAACATCAAATGACAACGAGATTGAGGAAGGGTCAGACAGTAGTGACGATGAACGTAGTTCTTTTTATGAGATAAAGAAATGCAACAAT
GATTCAGATTTCTACGAAGAGGCATTGGCTAATCTTTATCAGCCXCTAGCTGCTGCTTGGTCCCAAGAGTCTTTAGGTGTATAG
Edits in Original Sequence 
(5')XTTTTAGACGATATGTTGCTTGCCGGCGTTAGTCCAAATGAGTACACATATACAACGATTATGCATGGTTATGCATCTCTTGGTGA
TATTGAAAAAGCTTGTGAATATTTTTCAAAAATTAAAAATGAGGGTTTAGAGCTCGACATATATACATATGAGGCGTTACTCAAGGCATG
CTGTAAATCAGGCAGGATGCAAAGTGCTTTGACGGTGACAAAAGAAATGAGTGCCAAAAGCATCCCAAGGAATACCTTTGTTTATAACAT
ATTAATTGATGGATGGGCTCGACGAGGTGATGTCTGGGAGGCTGCTGACCTGATGCAACAGATGAGACAAGAAGGGGTTCCACCTGACAT
CCATACATTCACGTCATTCATAAATGCTTGTTGTAAAGCTGGAGAAATGCAAAGAGCAATGAAAGCAGTTGAAGAGATGGAAACTGTTGG
GATCAAACCTAACTTAAAGACCTATACCACTCTTATACATGGTTGGGCACGGGCTTCTCTTCCCGAGAAGGGTTTGAAATGTTTTGAACA
GATGAAGCAGTCTGGTTTGAAACCTGACAAAGCTGTATACCACTGTTTAATGACATCATTGTTGTCAAGGGCGGCAGTTGCTGATCAAGA
TTACATTATAACgAGAATCCAACATGTTTGTGAAGAGATGGTGGAGTXCTGGATTGACTGTTGATATGGGAACTGCAGTTCATTGGTCCA
AGTGCTTGAGAAAAATTGAGAGGACTGGTGGTGATATAACAAAATCCCTTCAAAAGACCTTCCCACCTGATTGGAGTTCTCACCGAACTC
TTAATGGAACATCAAATGACAACGAGATTGAGGAAGGGTCAGACAGTAGTGACGATGAACGTAGTTCTTTTTATGAGATAAAGAAATGCt
AACAATGATTCAGATTTCTACGAAGAGGCATTGGCaTAATCTTTATCAGCCXCTAGCTGCTGCTTGGTCCCAAGAGTCTTTAGGTGTATA
G(3')ATGGAATTTTGCCACTAGTTTGGCTTGATCAAGATTGTTTTATTTTTTCGTAAACAACCTCTCTATTTCTACGAGGTAAGGGTAA
GGTTTGTGTACACTCTACCCTTCTTGAACCTTGGGATTACGTTGGGTATGTGATTATTTGGCTTGATCAAGATTGTGCAATTGATTCCAT
ATTCTTGAATTGTAAATGTCTCTTTTTGGTTTTAGACTTGAAGTAGCTAAAGGGATTAGTTTTGGATGTACAAATATGTATTAAATTTGT
AACGATTGTCAAATGCACA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan