ESTScan Details for Unigene SGN-U324080

Score 
1630
Direction 
Forward
Predicted Peptide Sequence 
NDLMNMTKKKENVVEAVQGVVKFAKEFMELIDAADATAQADIAREALKRLAAAGSIKGALRGQELRGVALRLANHGELTRLSNLVNNLIS
VGAGREAAFAAALLGDNVLMEKAWQETGMLAEAVLHAHAHGRPSMRTLVQSWNKMLQKELEHTPSMKTDAAAAFLASLEGSKLTSLADAA
KKPPIEILPPGMASLYGPNPGQAKPLLGKPGLPQPGKPLLLEGSKTTAPIASVPAGSNTPATSESGVPLKSENGASTTPESSNPPASDSG
AAPASDSGAAPASDSGAAPASETGAAPTTETGAAPPATEIGATPPVIESGAASATETGATPAESSTTQTSNLDSSVAADAVVPATPALNE
SDYLALVPSTSAPAEPTTIGAIVPSTGPPPATDNKKPSVPGERLMIDXFLRSLTAPSPFHADSLSYEW
Predicted Coding Sequence 
XXGAACGATCTTATGAACATGACTAAGAAAAAGGAAAATGTTGTTGAAGCTGTTCAAGGAGTAGTTAAATTTGCCAAGGAATTTATGGAA
CTCATTGATGCTGCAGATGCTACAGCACAAGCTGATATTGCTCGTGAAGCTCTTAAAAGACTAGCTGCTGCTGGTTCTATAAAGGGAGCT
CTGCGAGGTCAGGAATTAAGAGGTGTTGCTTTACGTCTTGCAAATCATGGGGAGTTAACACGACTTAGTAACTTGGTAAACAACTTGATA
TCAGTTGGTGCGGGACGGGAGGCTGCATTTGCAGCTGCACTTTTGGGAGACAATGTACTTATGGAGAAAGCATGGCAGGAAACTGGGATG
CTTGCTGAGGCTGTACTACATGCACATGCTCATGGCCGACCTTCAATGAGAACCTTGGTCCAGTCATGGAACAAAATGTTGCAGAAGGAG
TTGGAACACACTCCATCAATGAAAACTGATGCCGCGGCTGCATTTCTGGCCTCCCTCGAGGGGTCTAAGCTCACAAGTTTGGCAGATGCT
GCGAAGAAGCCACCAATTGAAATACTGCCACCTGGTATGGCATCTCTATACGGTCCAAATCCCGGTCAAGCCAAACCTCTTTTGGGGAAG
CCGGGGTTGCCACAACCTGGCAAACCACTACTTCTGGAAGGATCTAAAACAACAGCACCAATTGCTTCTGTTCCTGCTGGAAGCAACACA
CCTGCAACATCAGAATCAGGTGTTCCTCTTAAATCAGAAAACGGGGCTTCCACTACACCAGAATCAAGTAATCCACCTGCGTCAGACTCT
GGTGCTGCACCGGCATCAGACTCTGGTGCTGCACCCGCATCAGACTCTGGTGCTGCACCCGCATCAGAAACTGGCGCTGCACCCACGACA
GAAACTGGCGCTGCACCACCGGCGACAGAAATTGGTGCTACACCACCCGTGATAGAATCTGGTGCTGCATCCGCAACAGAAACCGGTGCC
ACTCCTGCAGAATCAAGTACAACCCAAACATCAAACTTGGATTCTTCAGTTGCTGCTGATGCAGTTGTGCCTGCTACACCAGCATTGAAT
GAATCAGACTATCTAGCGTTGGTCCCATCAACATCAGCTCCTGCAGAACCAACTACAATTGGCGCAATTGTTCCATCCACAGGTCCACCA
CCTGCCACCGATAACAAGAAACCAAGTGTTCCTGGTGAACGTCTAATGATTGATXTTTTCTTGCGTTCCCTTACAGCACCCTCACCTTTC
CATGCAGATTCTCTGTCGTACGAGTGG
Edits in Original Sequence 
(5')XXGAACGATCTTATGAACATGACTAAGAAAAAGGAAAATGTTGTTGAAGCTGTTCAAGGAGTAGTTAAATTTGCCAAGGAATTTAT
GGAACTCATTGATGCTGCAGATGCTACAGCACAAGCTGATATTGCTCGTGAAGCTCTTAAAAGACTAGCTGCTGCTGGTTCTATAAAGGG
AGCTCTGCGAGGTCAGGAATTAAGAGGTGTTGCTTTACGTCTTGCAAATCATGGGGAGTTAACACGACTTAGTAACTTGGTAAACAACTT
GATATCAGTTGGTGCGGGACGGGAGGCTGCATTTGCAGCTGCACTTTTGGGAGACAATGTACTTATGGAGAAAGCATGGCAGGAAACTGG
GATGCTTGCTGAGGCTGTACTACATGCACATGCTCATGGCCGACCTTCAATGAGAACCTTGGTCCAGTCATGGAACAAAATGTTGCAGAA
GGAGTTGGAACACACTCCATCAATGAAAACTGATGCCGCGGCTGCATTTCTGGCCTCCCTCGAGGGGTCTAAGCTCACAAGTTTGGCAGA
TGCTGCGAAGAAGCCACCAATTGAAATACTGCCACCTGGTATGGCATCTCTATACGGTCCAAATCCCGGTCAAGCCAAACCTCTTTTGGG
GAAGCCGGGGTTGCCACAACCTGGCAAACCACTACTTCTGGAAGGATCTAAAACAACAGCACCAATTGCTTCTGTTCCTGCTGGAAGCAA
CACACCTGCAACATCAGAATCAGGTGTTCCTCTTAAATCAGAAAACGGGGCTTCCACTACACCAGAATCAAGTAATCCACCTGCGTCAGA
CTCTGGTGCTGCACCGGCATCAGACTCTGGTGCTGCACCCGCATCAGACTCTGGTGCTGCACCCGCATCAGAAACTGGCGCTGCACCCAC
GACAGAAACTGGCGCTGCACCACCGGCGACAGAAATTGGTGCTACACCACCCGTGATAGAATCTGGTGCTGCATCCGCAACAGAAACCGG
TGCCACTCCTGCAGAATCAAGTACAACCCAAACATCAAACTTGGATTCTTCAGTTGCTGCTGATGCAGTTGTGCCTGCTACACCAGCATT
GAATGAATCAGACTATCTAGCGTTGGTCCCATCAACATCAGCTCCTGCAGAACCAACTACAATTGGCGCAATTGTTCCATCCACAGGTCC
ACCACCTGCCACCGATAACAAGAAACCAAGTGTTCCTGGTGAACGTCTAATGATTGATXTTTTCTTGaCGTTCCCTTACAGCACCCTCAC
CTTTCCATGCAGATTCTCTGTCGTACGAGTGG(3')TATGGATTTCTTGCATTACATTTCTAATTGTGGAGTAGATATATATTTATACTC
GTTTATATGCTTTAAGTACTACACATGCTGCGGTTGAATCTGTGAGTTGATAGGATTGTTAGATTATAGTAGGTGTTAGGTTTGTTTTGT
TAATATCACTTTGTCCTGTCTGATCCTTATTCTTTGATTTGGTGGAATTTTGCCAATCCACGTTNAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan