ESTScan Details for Unigene SGN-U324143

Score 
1047
Direction 
Forward
Predicted Peptide Sequence 
MASDLNFELSKKTHIFHLKVWVLLAIFVGFFIVVILLLLPFCSSRKKSRKSHDTLPISKIPSVCKEIRVDQNSASNYGSHYRNPLAFQDT
YCEKDSDKLLAHSNIDKMKDFDNNSQSGSFNYLDKDGTFESGEKEVAGTLNHPSHPANVPSPLSGLPEFSHLGWGHWFTLRDLETATNKF
AKDNIIGEGGYGIVYRGQLINGTEVAVKKLLNNLGQAEKEFQVEVEAIGHVRHKNLVRLLGYCIEGTHRLLVYEXRKQWEFRAVATGAMQ
QHGYLTWEARMKILLGTAKALAYLHEAIEPKVVHRDIKSSNILIDEDFNAKISDFGLAKLLGAGKSHITTRVMGTFGYVAPEYANSGLLN
EKSDVYSYGVVLLEAITGRDPVDYGRPAPEVNLVDWLKMMVGSKRSEEVVDPTIETRPSTTALKRALLTTLRCLDPDSDKRPTMSQVVRM
LESEEYPNPERDEDGXKNQAGAVETESHNRKSTDSSDRPILMTKTRSDHRTNA
Predicted Coding Sequence 
ATGGCATCTGACCTTAATTTCGAACTGTCAAAGAAAACTCATATATTTCATCTCAAGGTGTGGGTTTTATTAGCCATCTTTGTTGGATTT
TTTATTGTGGTAATTCTTTTGCTACTGCCGTTTTGTTCTTCCCGTAAAAAATCAAGAAAATCTCATGATACGCTACCCATAAGCAAAATT
CCTTCTGTGTGCAAAGAAATAAGAGTTGATCAAAACTCAGCAAGCAACTATGGGAGCCACTATAGGAATCCCCTTGCATTTCAAGACACA
TACTGTGAGAAAGATTCCGATAAGCTTTTGGCACATTCAAATATTGACAAGATGAAAGATTTTGACAATAATAGTCAATCAGGTTCATTT
AATTATTTAGACAAAGACGGAACATTTGAGTCCGGGGAAAAGGAAGTTGCCGGAACACTAAATCATCCTTCACATCCTGCAAACGTCCCA
TCTCCTCTCTCTGGTTTGCCTGAGTTCTCTCACCTAGGTTGGGGCCATTGGTTTACTCTGAGGGACCTTGAAACTGCAACCAACAAGTTT
GCTAAGGATAACATCATTGGAGAGGGTGGTTATGGCATTGTTTACCGTGGACAGCTGATTAACGGAACTGAAGTCGCTGTTAAAAAGCTA
TTGAATAATTTAGGACAAGCAGAGAAAGAATTTCAAGTGGAAGTTGAGGCCATCGGTCATGTCCGACATAAGAATTTGGTTAGACTTTTG
GGCTACTGTATTGAAGGAACTCACAGGTTACTAGTTTATGAGXTGCGTAAACAATGGGAATTTAGAGCAGTGGCTACTGGAGCTATGCAA
CAGCACGGATACCTTACATGGGAAGCACGGATGAAGATTCTCCTTGGCACTGCTAAAGCTCTTGCATATTTACATGAGGCAATTGAGCCC
AAGGTGGTGCATCGTGACATCAAGTCAAGCAACATATTGATAGATGAAGACTTCAATGCAAAAATTTCTGATTTTGGCCTGGCCAAGTTG
CTAGGTGCAGGGAAGAGTCACATTACAACCAGAGTTATGGGCACGTTCGGATATGTAGCTCCTGAGTATGCAAATAGTGGTCTACTGAAT
GAAAAGAGTGATGTGTACAGCTATGGTGTTGTGCTTCTGGAAGCCATCACTGGAAGAGATCCCGTGGATTATGGTCGCCCTGCTCCCGAG
GTGAATCTTGTTGACTGGCTCAAGATGATGGTTGGCAGCAAACGCTCGGAAGAAGTAGTCGATCCAACAATCGAAACAAGGCCTTCCACA
ACCGCCCTTAAGCGAGCTCTACTGACTACTTTAAGATGTCTTGATCCAGATTCAGATAAGAGGCCAACAATGAGTCAAGTAGTTCGAATG
CTTGAATCTGAGGAATATCCAAACCCCGAGAGGGACGAAGACGGAGAXAAGAATCAGGCAGGTGCTGTAGAAACAGAATCTCATAATCGA
AAATCTACAGATAGCAGTGATAGACCAATTTTAATGACGAAAACTAGAAGCGATCATCGAACAAATGCATAA
Edits in Original Sequence 
GACTGATAATAACCCCACATTTCCATCTCAAAGATTTCATGTTTTCTTTGTTGAGATTTCTCTTTGCCTTTTACTTCAAAGGAAGGTTTC
CTTTTAGTATATGCTTCAATTAAGGAAGGTCTATTTTCCCATTTCTAAAAGGGTCCCTTTTTTTTTTTTTTTGGGTATTTTTGTATATTT
GAGAAATGGGATTCTTGATTTGAAAATGGCTTCATTTTCCTAAATGGGGTTTGGGGATTTTAGGAGTATAAGAGATCTGGGGTTTGGATT
TTTCTTCATTTTGTGAGTAGAGGTTGTGTGTAGTGTTGGTAGAGGCTTACTTCTACTTCTGGGATCTCATCATAAATAGGTTTCATTAAG
(5')ATGGCATCTGACCTTAATTTCGAACTGTCAAAGAAAACTCATATATTTCATCTCAAGGTGTGGGTTTTATTAGCCATCTTTGTTGG
ATTTTTTATTGTGGTAATTCTTTTGCTACTGCCGTTTTGTTCTTCCCGTAAAAAATCAAGAAAATCTCATGATACGCTACCCATAAGCAA
AATTCCTTCTGTGTGCAAAGAAATAAGAGTTGATCAAAACTCAGCAAGCAACTATGGGAGCCACTATAGGAATCCCCTTGCATTTCAAGA
CACATACTGTGAGAAAGATTCCGATAAGCTTTTGGCACATTCAAATATTGACAAGATGAAAGATTTTGACAATAATAGTCAATCAGGTTC
ATTTAATTATTTAGACAAAGACGGAACATTTGAGTCCGGGGAAAAGGAAGTTGCCGGAACACTAAATCATCCTTCACATCCTGCAAACGT
CCCATCTCCTCTCTCTGGTTTGCCTGAGTTCTCTCACCTAGGTTGGGGCCATTGGTTTACTCTGAGGGACCTTGAAACTGCAACCAACAA
GTTTGCTAAGGATAACATCATTGGAGAGGGTGGTTATGGCATTGTTTACCGTGGACAGCTGATTAACGGAACTGAAGTCGCTGTTAAAAA
GCTATTGAATAATTTAGGACAAGCAGAGAAAGAATTTCAAGTGGAAGTTGAGGCCATCGGTCATGTCCGACATAAGAATTTGGTTAGACT
TTTGGGCTACTGTATTGAAGGAACTCACAGGTTACTAGTTTATGAGXTGCGTAAACAATGGGAATTTAGAGCAGTGGCTACaTGGAGCTA
TGCAACAGCACGGATACCTTACATGGGAAGCACGGATGAAGATTCTCCTTGGCACTGCTAAAGCTCTTGCATATTTACATGAGGCAATTG
AGCCCAAGGTGGTGCATCGTGACATCAAGTCAAGCAACATATTGATAGATGAAGACTTCAATGCAAAAATTTCTGATTTTGGCCTGGCCA
AGTTGCTAGGTGCAGGGAAGAGTCACATTACAACCAGAGTTATGGGCACGTTCGGATATGTAGCTCCTGAGTATGCAAATAGTGGTCTAC
TGAATGAAAAGAGTGATGTGTACAGCTATGGTGTTGTGCTTCTGGAAGCCATCACTGGAAGAGATCCCGTGGATTATGGTCGCCCTGCTC
CCGAGGTGAATCTTGTTGACTGGCTCAAGATGATGGTTGGCAGCAAACGCTCGGAAGAAGTAGTCGATCCAACAATCGAAACAAGGCCTT
CCACAACCGCCCTTAAGCGAGCTCTACTGACTACTTTAAGATGTCTTGATCCAGATTCAGATAAGAGGCCAACAATGAGTCAAGTAGTTC
GAATGCTTGAATCTGAGGAATATCCAAtACCCCGAGAGGGACGAAGACGGAGAXAAGAATCAGGCAGGTGCTGTAGAAACAGAATCTCAT
AATCGAAAATCTACAGATAGCAGTGATAGACCAATTTTAATGACGAAAACTAGAAGCGATCATCGAACAAATGCATAA(3')GCTTGAAC
TACAGAAAGTTACAGTGAGCTGAAATGATTGAAATGGCACAAAAAAGAGCCATATATACATACATATATATATATTTCTTCCATTTGGTA
TGTCTTATAATATGGTAGTAGATGTTTGAGATAATCATTTTTTGTGTGTATGAAAGTCAGAGTCACTTAGTATATAAAAGTTCCTCATTT
TTGACTCTGTGTTCTTTACAGATATGGGTAATGTATAGATAGTTGACAACTTCACATGCCCTTTTAGCAAAAGATATGTAAAAGGTTTCA
TTTGTGATTGTCTATGAAAAAAACCACTAGTTTTTGTTCTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAANCTTGGGGG
GGGGGGCGGGGCCCCATTTCCCCCTAAGGGGGGCGAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan