ESTScan Details for Unigene SGN-U324164

Score 
279
Direction 
Forward
Predicted Peptide Sequence 
QAFYSYNLSNRISVTPTPSSVPNLXVTSEVATATAAVPHASEPPNAAASALRRAHLALAAAILLLLSVSLLSVASTSSSNLTIPIRIPSX
YDTISLNNPLVDDLADADYRSSDDRIDELDVADSNNNNDDEFLLSNESEEDDEEIINQYPRVSSTYFYDQRHGVVRRAFNKRSIEEWEDY
VNFESRMKLGLGFKSDESKAAFGSDDLPVDXANEDEVEEIESVEDALLLKGSPLREGWGEWFEKKSDFLRRDRMFKSNX
Predicted Coding Sequence 
CAGGCATTTTACAGTTATAACCTTTCTAACAGAATCTCAGTCACCCCAACACCCTCCTCCGTCCCAAACCTTXCGGTGACATCTGAAGTC
GCCACCGCCACCGCCGCCGTACCACATGCTTCGGAACCTCCGAACGCGGCGGCGTCCGCTTTACGGCGCGCACATTTGGCCTTAGCGGCA
GCGATTCTCCTCCTCCTCTCTGTTTCACTCCTCTCAGTCGCCTCAACTTCTTCCTCCAACCTAACAATCCCCATCCGCATCCCCTCCAAX
TACGACACCATTTCACTGAACAACCCTCTCGTCGACGATTTAGCTGACGCTGATTACCGCTCCTCAGATGACCGCATTGACGAGCTCGAC
GTTGCTGACAGTAACAACAATAACGATGATGAGTTCCTCTTATCCAATGAATCCGAAGAGGACGATGAAGAAATCATCAATCAATACCCT
AGGGTTTCGTCGACATATTTCTACGATCAGAGGCACGGAGTTGTACGGAGAGCGTTTAACAAACGATCAATTGAGGAATGGGAAGATTAC
GTTAATTTTGAATCGAGGATGAAGTTAGGATTAGGGTTTAAGAGTGATGAATCTAAGGCCGCGTTTGGATCGGATGATCTTCCAGTGGAT
GXTGCAAATGAGGATGAAGTTGAGGAAATTGAGAGTGTTGAAGATGCTTTGTTACTAAAAGGATCACCTTTGAGGGAAGGGTGGGGTGAG
TGGTTTGAAAAGAAGAGTGATTTTTTGAGGCGTGACAGAATGTTCAAGTCAAATCXX
Edits in Original Sequence 
(5')CAGGCATTTTACAGTTATAACCTTTCTAACAGAATCTCAGTCACCCCAACACCCTCCTCCGTCCCAAACCTTXCGGTGACATCTGA
AGTCGCCACCGCCtACCGCCcGCCGTACCACATGCTTCGGAACCTCCGAACGCGGCGGCGTCCGCTTTACGGCGCGCACATTTGcGCCTT
AGCGGCAGCGATTCTCCTCCTCCTCTCTGTTTCACTCCTCTaCAGTCGCCTCAACTTCTTCCTCCAACCTAACAATCCCCATCCGCATCC
CCTCCAAXTACGACACCATTTCACTGAACAACCCTCTCGTCGACGATTTAGCTGACGCTGATTACCGCTCCTCAGATGACCGCATTGACG
AGCTCGACGTTGCTGACAGTAACAACAATAACGATGATGAGTTCCTCTTATCCAATGAATCCGAAGAGGACGATGAAGAAATCATCAATC
AATACCCTAGGGTTTCGTCGACATATTTCTACGATCAGAGGCACGGAGTTGTACGGAGAGCGTTTAACAAACGATCAATTGAGGAATGGG
AAGATTACGTTAATTTTGAATCGAGGATGAAGTTAGGATTAGGGTTTAAGAGTGATGAATCTAAGGCCGCGTTTGGATCGGATGATCTTC
CAGTGGATGXTGCAAATGAGGATGAAGTTGAGcGAAATTGAGAGTGTTGAAGATGCTTTGTTACTAAAAGGATCACCTTTGAGGGAAGGG
TGGGGTGAGTGGTTTGAAAAGAAGAGTGATTTTTTGAGGCGTGACAGAATGTTCAAGTCAAATCXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan