ESTScan Details for Unigene SGN-U324300

Score 
163
Direction 
Reverse
Predicted Peptide Sequence 
MWYTGIIPNSKTTNFESASIQVDSSSSTTNVNLRIXINLVQKSVGRLVPTPTTYPDEXPLRETGFQHEAERGNSDQWSQTETFVWNICKK
LKSSAECRMRYSFCFPFFTKDYYIFFISMHGNVLYPKNQAYVTQDETLLATLTVQEAVYYSAQLQLPVSMTKSEKKQIAEQTIKEMGLQD
AMNTRIGGFGNKGISGGEKRRLSVCXGDSNAAKTSFPDEPTSGLDSAASYYVMSGISRQREGRTIIASIHQPSAEVFNLFHSFAFCLQEE
PYISDLIIGSIEIRLANHSLEVEDRSTLSSNSRRMRRNLSPNSMIEFRRELHNKSSXNEKAQKSEDMDEKD
Predicted Coding Sequence 
ATGTGGTATACTGGTATTATTCCAAACTCGAAAACAACAAATTTTGAATCTGCATCCATTCAAGTAGATTCTTCGTCCTCTACTACAAAT
GTTAACCTCCGCATTCXGATCAATTTAGTTCAAAAATCAGTTGGTCGATTAGTGCCAACCCCTACTACATATCCTGATGAAXCACCTCTC
AGGGAGACTGGATTTCAGCACGAGGCAGAGCGGGGAAATTCTGATCAATGGTCACAAACAGAAACTTTCGTATGGAACATCTGTAAGAAA
TTAAAATCTTCAGCTGAATGCCGCATGCGCTACTCATTTTGTTTTCCTTTTTTCACAAAAGATTACTATATTTTTTTTATTAGCATGCAT
GGTAATGTTCTTTATCCTAAAAATCAGGCATATGTGACTCAAGATGAAACTCTGTTAGCAACACTAACAGTTCAAGAAGCAGTTTACTAC
TCTGCACAACTCCAACTCCCAGTTTCCATGACAAAATCAGAGAAAAAACAAATAGCAGAGCAGACTATTAAGGAGATGGGGTTGCAAGAT
GCAATGAACACAAGAATTGGAGGATTTGGTAATAAAGGAATTAGTGGAGGAGAAAAGAGAAGACTTAGTGTTTGCAXTGGAGATTCTAAC
GCGGCCAAAACTTCTTTTCCTGATGAACCAACCAGCGGCCTCGACAGTGCTGCATCTTATTACGTGATGAGCGGAATTTCACGTCAAAGA
GAGGGAAGAACCATTATTGCATCTATCCATCAGCCAAGTGCTGAAGTTTTCAACCTTTTCCACAGTTTTGCCTTCTGTCTTCAGGAAGAA
CCGTATATTTCGGACCTGATTATCGGATCAATCGAAATCAGACTGGCGAACCATAGCTTAGAAGTAGAAGATAGGTCAACACTTTCCTCT
AACTCTCGAAGAATGAGACGAAACCTGAGCCCTAATTCCATGATCGAATTCAGAAGAGAACTCCATAACAAGAGTAGCXGTAACGAAAAA
GCGCAGAAATCTGAGGACATGGATGAAAAAGATTAA
Edits in Original Sequence 
TTTTTTTTTTTATCAAAAAATTTCACTAAAAAAATAAAAATTGTAACATATTTCGTTGTCCCTTACACTAAACAAG(5')ATGTGGTATA
CTGGTATTATTCCAAACTCGAAAACAtACAAATTTTGAATCTGCATCCATTCAAGTAGATTcCTTCGTCCTCTACTACAAATGTTAACCT
CCGCATTCXGATCAATTTAGTTCAAAAATCAGTTcGGTCGATTAGTGCCAACCCCTACTACATATaCCTGATGAAXCACCTCTCAGGGAG
ACTGGATTTCAGCACGAGGCAGAGCGGGGAAATTCTGATCAATGGTCACAAACAGAAACTTTCGTATGGAACATCTGTAAGAAATTAAAA
TCTTCAGCTGAATGCCGCATGCGCTACTCATTTTGTTTTCCTTTTTTCACAAtAAGATTACTATATTTTTTTTATTAGCATGCATGGTAA
TGTTCTTTATCCTAtAAAATCAGGCATATGTGACTCAAGATGAAACTCTGTTAGCAACACTAACAGTTCAAGAAGCAGTTTACTACTCTG
CACAACTCCAACTCCCAGTTTCCATGACAAAATCAGAGAAAAAACAAATAGCAGAGCAGACTATTAAGGAGATGGGGTTGCAAGATGCAA
TGAACACAAGAATTGGAGGATTTGGTAATAAAGGAATTAGTGGAGGAGAAAAGAGAAGACTTAGTGTTTGCAXTGGAGATTCTAACGCGG
CCAAAACTTCTTTTCCtTGATGAACCAACCAGCGGCCTCGACAGTGCTGCATCTTATTACGTGATGAGCGGAATTTCACGTCAAAGAGAG
GGAAGAACCATTATTGCATCTATCCATCAGCCAAGTGCTGAAGTTTTCAACCTTTTCCACAGTTTaTGCCTTCTGTCTTCAGGAAGAACC
GTATATTTCGGACCTGATTATCGGATCAATCGAAATCAGACTGGCGAACCATAGCTTAGAAGTAGAAGATAGGTCAACACTTTCCTCTAA
CTCTCGAAGAATGAGACGAAACCTGAGCCCTAATTCCATGATCGAATTCAGAAGAGAACTCCATAACAAGAGTAGCXGTAACGAAAAAGC
GCAGAAATCTGAGGACATGGATGAAAAAGATTAA(3')ATTTCACCCCTTGCTAAACGAAAATAGCAAATTGTTTATATTTTTTGTTTGT
TTAGCGCAATTCAACCTGCAGCCCG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan