ESTScan Details for Unigene SGN-U324308

Score 
668
Direction 
Forward
Predicted Peptide Sequence 
MGRTHSCSRVVTASYSAASGPGGSSGGDREILVQHLLVKEDDQKLLLDLQKKTAEGEDLSDLAVEYSMCPSKEDGGMLGWVRKGQMVPEF
EEAAFGAPLNKVVKCKTKFGWHLLQVLSEREESVLEHIQPNEFHVRLQDPSFLEEAQLIDVREPEEVAQASVPGFQILPLRQFGVWGPEI
TTKFDPQKDTYVLCHHGVRSLQVAKWLQTQGFRKVFNVAGGIHEYAVKVDPSIPIIEAGTLRVPALSPAPPLGDRAKFGQNHFVFDLSYN
FDSNILGTQSM
Predicted Coding Sequence 
ATGGGTCGTACTCATTCTTGTTCGAGAGTGGTTACAGCTTCATATAGTGCTGCGAGTGGTCCTGGAGGCAGTTCTGGAGGCGATCGGGAG
ATATTGGTGCAGCATTTACTTGTCAAAGAAGATGATCAGAAACTTCTACTGGACCTTCAGAAAAAAACTGCTGAAGGAGAGGATCTAAGT
GATCTGGCCGTTGAGTATTCTATGTGTCCATCAAAAGAAGATGGGGGAATGCTGGGCTGGGTGAGAAAAGGGCAAATGGTGCCAGAATTT
GAAGAAGCTGCATTTGGTGCACCTCTGAATAAGGTTGTAAAGTGCAAAACTAAGTTTGGGTGGCATTTGTTGCAAGTTCTATCTGAGAGG
GAGGAATCTGTACTTGAACACATCCAGCCAAACGAGTTTCATGTGAGGTTGCAAGATCCGTCTTTCCTGGAAGAGGCTCAATTGATTGAT
GTTCGAGAACCAGAGGAAGTGGCCCAGGCTTCTGTACCAGGATTTCAGATTCTTCCTCTTCGCCAATTTGGAGTCTGGGGACCAGAAATA
ACTACTAAGTTTGATCCTCAGAAGGACACTTATGTATTGTGTCATCATGGCGTGAGGTCACTACAAGTCGCCAAGTGGTTGCAGACACAG
GGATTCAGGAAGGTATTTAACGTGGCCGGAGGAATCCATGAATATGCTGTCAAAGTTGATCCATCGATCCCAATTATTGAAGCGGGTACT
CTTCGTGTCCCTGCTCTTTCCCCTGCCCCGCCTCTCGGTGACAGAGCTAAGTTTGGACAAAACCATTTTGTTTTTGATTTGTCCTACAAT
TTTGATTCAAACATCCTGGGAACACAATCAATGTGA
Edits in Original Sequence 
ATGAAATGGAGAGAGTATTAGATATAGTTTTCTAATCTTTTAAGAAAAATTGCATAAAATTGATTTCAATTTGCATTCCAAATTTCTCAA
AAATCTCAAAAAATGTTGAGAATTTCTTCTTCTTCTTCTTCTTTGCATGTTCCCTCAATTTGTGGAGCACCAGTTAGTTTCATTCTTTCT
TTCTTGAATCCATCTTCTCGTAAAGTATCAAACTTTACTCGCTTAGCTTTACTTCACTCGACAACCCTTTTCCCCAATTCACGTAATTTC
CAGTTTCCCACCTTCAGAAGGGTGTCAACAATG
(5')ATGGGTCGTACTCATTCTTGTTCGAGAGTGGTTACAGCTTCATATAGTGCTGC
GAGTGGTCCTGGAGGCAGTTCTGGAGGCGATCGGGAGATATTGGTGCAGCATTTACTTGTCAAAGAAGATGATCAGAAACTTCTACTGGA
CCTTCAGAAAAAAACTGCTGAAGGAGAGGATCTAAGTGATCTGGCCGTTGAGTATTCTATGTGTCCATCAAAAGAAGATGGGGGAATGCT
GGGCTGGGTGAGAAAAGGGCAAATGGTGCCAGAATTTGAAGAAGCTGCATTTGGTGCACCTCTGAATAAGGTTGTAAAGTGCAAAACTAA
GTTTGGGTGGCATTTGTTGCAAGTTCTATCTGAGAGGGAGGAATCTGTACTTGAACACATCCAGCCAAACGAGTTTCATGTGAGGTTGCA
AGATCCGTCTTTCCTGGAAGAGGCTCAATTGATTGATGTTCGAGAACCAGAGGAAGTGGCCCAGGCTTCTGTACCAGGATTTCAGATTCT
TCCTCTTCGCCAATTTGGAGTCTGGGGACCAGAAATAACTACTAAGTTTGATCCTCAGAAGGACACTTATGTATTGTGTCATCATGGCGT
GAGGTCACTACAAGTCGCCAAGTGGTTGCAGACACAGGGATTCAGGAAGGTATTTAACGTGGCCGGAGGAATCCATGAATATGCTGTCAA
AGTTGATCCATCGATCCCAAcTTATTGAAGCGGGTACTCTTCGTGTCCCTGCTCTTTCCCCTGCCCCGCCTCTCGGTGACAGAGCTAAGT
TTGGACAAAACCATTTTGTTTTTGATTTGTCCTACAATTTTGATTCAAACATCCTGGGAACACAATCAATGTGA(3')ATGGTTGATCTT
AGGACATCTTTTGTATGCTATCTCTGTATTTCCAACATGCCTCAATTATCAAATCATACAATTTGCTACGGTTTTCACCATATTAGAGAT
AACACAATGCATAATTTTAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan