ESTScan Details for Unigene SGN-U324603

Score 
459
Direction 
Forward
Predicted Peptide Sequence 
MAEGRGSSLVHLLVIILSLVAFGFAIAAERRRSTGTLHDDTITNRTYCVYTSDVATGYGVGAFLFLLSGEALLMGVTKCMCFGRPLSPGS
NRAWTIIYFVSSWLTFLVAEACVIAGAKQNAYHTKYRDMLLAENFSCETLRKGVFVAGAVFIVATMILNVYFYMYFTKATTQPAHKTNRT
SSNIGMAGYAXDFAEETLA
Predicted Coding Sequence 
ATGGCGGAAGGCAGAGGATCTTCCCTTGTTCATCTACTCGTGATTATACTGAGCTTAGTCGCTTTCGGATTCGCCATTGCCGCCGAACGT
CGCCGGAGCACTGGTACTCTGCATGATGATACTATTACCAATCGTACATATTGTGTTTACACCTCAGACGTTGCTACTGGATATGGAGTA
GGTGCTTTCTTGTTTCTTCTTTCAGGTGAGGCATTGCTTATGGGAGTGACAAAATGCATGTGCTTCGGAAGACCTTTATCTCCTGGTTCA
AATCGTGCATGGACCATTATATACTTCGTATCATCATGGTTGACATTCCTGGTTGCTGAGGCATGTGTTATTGCTGGAGCAAAGCAAAAT
GCGTACCACACCAAGTATCGTGATATGCTCTTAGCAGAAAACTTCTCTTGCGAAACGCTAAGGAAAGGTGTCTTTGTTGCTGGAGCAGTC
TTTATCGTTGCAACCATGATCCTTAATGTGTATTTCTACATGTATTTCACGAAGGCTACTACTCAGCCAGCTCACAAGACAAATCGTACT
AGCTCAAATATCGGGATGGCTGGTTATGCAXTAGATTTTGCAGAAGAAACTTTAGCCTAG
Edits in Original Sequence 
GGGCGATTGGCGGCCAATCGGCCGAATTGAAAAACACACTCACTAAGAACACACAGTTCACACACACTCTTGAACTGAAGTGAAAAGCCC
TAAATCGAAGCTTTGAGAA
(5')ATGGCGGAAGGCAGAGGATCTTCCCTTGTTCATCTACTCGTGATTATACTGAGCTTAGTCGCTTTCG
GATTCGCCATTGCCGCCGAACGTCGCCGGAGCACTGGTACTCTGCATGATGATACTATTACCAATCGTACATATTGTGTTTACACCTCAG
ACGTTGCTACTGGATATGGAGTAGGTGCTTTCTTGTTTCTTCTTTCAGGTGAGGCATTGCTTATGGGAGTGACAAAATGCATGTGCTTCG
GAAGACCTTTATCTCCTGGTTCAAATCGTGCATGGACCATTATATACTTCGTATCATCATGGTTGACATTCCTGGTTGCTGAGGCATGTG
TTATTGCTGGAGCAAAGCAAAATGCGTACCACACCAAGTATCGTGATATGCTCTTAGCAGAAAACTTCTCTTGCGAAACGCTAAGGAAAG
GTGTCTTTGTTGCTGGAGCAGTCTTTATCGTTGCAACCATGATCCTTAATGTGTATTTCTACATGTATTTCACGAAGGCTACTACTCAGC
CAGCTCACAAGACAAATCGTACTAGCTCAAATATCGGGATGGCTGGTTATGCAXTAGATTTTGCAGAAGAAACTTTAGCCTAG(3')GCT
CTATATTACCTACATCATTGACACTTTGGTTGTATAATGTACTACTCCATATAAGTTTGTCTATTATATTAAATCTGTTCTTTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan