ESTScan Details for Unigene SGN-U324640

Score 
432
Direction 
Forward
Predicted Peptide Sequence 
MVEKGEKPTVISYGALLSALEKGKLYDEALQVWKHMIKVGIEPNLYAYTIMASIYTAQGKFNIVDSIIKEMVTTGVEPTVVTFNAIISGC
ARNGMESVAYEWFQRMKTQNITPNEVSYEVLIEALANDGKPRLAYELYVRALTEGLSLSTKAYDAVISSTQAYGASIDLSILGPRPPEKR
NECKSGKXLSEFCHIADFPEEAGPLTGKKFXTAQTKGT
Predicted Coding Sequence 
ATGGTAGAGAAAGGTGAAAAACCTACAGTTATATCCTATGGAGCGTTGCTCAGTGCTCTAGAAAAAGGCAAGCTCTATGATGAAGCTCTT
CAGGTTTGGAAACATATGATCAAAGTGGGGATCGAGCCAAATTTGTATGCCTATACTATTATGGCATCAATTTACACTGCTCAAGGGAAA
TTTAACATAGTTGATTCTATCATCAAGGAGATGGTTACTACTGGAGTTGAGCCTACAGTTGTTACATTCAACGCTATTATTAGTGGATGT
GCTCGGAATGGTATGGAAAGTGTTGCATACGAGTGGTTTCAGCGTATGAAAACTCAAAACATAACCCCGAATGAGGTAAGCTATGAAGTG
CTAATTGAGGCTCTTGCCAATGATGGCAAGCCGAGGCTAGCATATGAGTTGTATGTGAGAGCTCTAACTGAAGGCCTGAGTCTTTCTACA
AAGGCTTATGATGCAGTCATCTCATCTACACAGGCATATGGTGCAAGTATTGATCTAAGCATTCTTGGCCCCCGCCCACCAGAAAAAAGA
AACGAGTGCAAATCAGGAAAAGXTTTGTCTGAATTCTGTCATATAGCCGATTTCCCAGAAGAAGCAGGCCCTTTGACAGGGAAGAAATTT
XTTACTGCTCAGACAAAAGGAACATGA
Edits in Original Sequence 
(5')ATGGTAGAGAAAGGTGAAAAACCTACAGTTATATCCTATGGAGCGTTGCTCAGTGCTCTAGAAAAAGGCAAGCTCTATGATGAAGC
TCTTCAGGTTTGGAAACATATGATCAAAGTGGGGATCGAGCCAAATTTGTATGCCTATACTATTATGGCATCAATTTACACTGCTCAAGG
GAAATTTAACATAGTTGATTCTATCATCAAGGAGATGGTTACTACTGGAGTTGAGCCTACAGTTGTTACATTCAACGCTATTATTAGTGG
ATGTGCTCGGAATGGTATGGAAAGTGTTGCATACGAGTGGTTTCAGCGTATGAAAACTCAAAACATAACCCCGAATGAGGTAAGCTATGA
AGTGCTAATTGAGGCTCTTGCCAATGATGGCAAGCCGAGGCTAGCATATGAGTTGTATGTGAGAGCTCTAACTGAAGGCCTGAGTCTTTC
TACAAAGGCTTATGATGCAGTCATCTCATCTACACAGGCATATGGTGCAAGTATTGATCTAAGCATTCTTGGCCCCCGCCCACCAGAAAA
AAGAAACGAGTGCAAATCAGGAAAAGXTTTGTCTGAATTCTGTCATATAGCCGATgTTCCCAGAAGAAGCAGGCCCTTTGACAGGGAAGA
AATTTXTTACTGCTCAGACAAAAGGAACATGA(3')TAAGCACAACTTTATATTGCTAGTGTGTGTAAGTATACAACTCATTGTCTATAT
GTTGTGCTGTTTTCAACAAAGAGTGTATGCTTCCTCTTGCGTAAAGCTACATTAGTTGATTGACTTTAGATGCAAAATCAGGCTTATCCC
AATTACCTTTTCACCTCTATCCTGGATTCAAGCATTCATTTTTTTTTTTGCACTTTCAATATATAAACCGCCCCATCATATTATTATCAA
TTTATACAATATGCCTCCCTTTAATTTGCGAATCAAATACAGTCATGCCTCCGAAAGTGTTTGTTCAAAACTCAACCTTGACAGAAAACA
CTAGTTGATTTTTTCCCTTTGTCCTAGCTTTAGTGGATATAGTTTATTCATACTTATTGCTGGGGTGAAATGGCATGTACCAACTTTGCT
AATTTTGTTCCCTTTGTACTGAAAAAGTTGAAACCCTTCCTTTTGTACTGAAAAAGTTGAAACCCTTTAAAGTTGTTTCCATAGAATTTC
AGGCTGACAGGTAATTTGAGGAAGCATATTAATATTTTTTTTGTACAACTACCAAAAAGCTTGCTAGAATCAATTCCTTGACATATGTTT
GATGTAAGTATTTATTGAACTAAATTTTTTTGTCCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan