ESTScan Details for Unigene SGN-U324707

Score 
378
Direction 
Forward
Predicted Peptide Sequence 
MGNQGQDMSMAIYKNSNFTGGCLEIRLFYVRITPCAVETVPDHLILRHLRREMGVTLEINSSRIPANDTGIITLRRDRVDKESSEVTFVS
TDSVRVSGPVEFEVHENENELILCGSLERVETTWANGNVLENDSRSGWSMDCYTAASFGNGGSAFFQPKFGVSLPSIEVYIAGCCSGVPV
ILSKTIQVSPRRKLPRQGMLDAIPEDEEVAKEQGSSNGFGRQIKPLTTEDMDDYEVEQKAGYGFYSDDMYPGEDGQLTWFNAGVRVGVGK
ASACAVGVGIGVGLLMLHIRQPLGICGGGFSRLLTFSHSEMDFLTGFNYWKKDFMVIKVGLILVAAGKXETPSAAAEEW
Predicted Coding Sequence 
ATGGGTAATCAAGGTCAGGATATGTCAATGGCAATCTACAAAAACTCGAATTTCACCGGAGGTTGTTTGGAAATCCGATTGTTTTATGTA
CGTATCACGCCATGCGCGGTTGAAACCGTACCGGACCACCTCATACTCCGCCACCTCCGCCGTGAGATGGGGGTAACGTTAGAGATCAAC
AGTTCGCGTATTCCGGCTAATGATACAGGCATCATAACCCTCCGACGTGATCGGGTTGATAAGGAATCGTCGGAGGTAACGTTTGTGAGC
ACGGACAGCGTTAGGGTTTCAGGGCCGGTGGAATTTGAGGTACATGAGAATGAAAATGAGTTAATACTTTGTGGGTCGTTGGAGAGAGTA
GAGACAACGTGGGCTAATGGTAATGTTTTAGAGAATGATTCGAGGAGTGGATGGAGCATGGATTGTTACACAGCAGCATCATTTGGGAAT
GGTGGATCAGCTTTTTTTCAGCCTAAATTTGGGGTTTCTTTACCATCAATCGAGGTATACATAGCGGGTTGCTGTTCAGGTGTCCCTGTG
ATTCTATCAAAGACAATTCAGGTCAGCCCGAGAAGGAAGTTACCTAGGCAGGGTATGTTGGATGCAATTCCAGAGGATGAGGAGGTTGCG
AAGGAGCAGGGGAGCTCGAATGGATTCGGACGACAAATAAAACCATTGACCACAGAGGATATGGACGATTATGAGGTGGAGCAGAAGGCT
GGATATGGTTTCTATTCAGACGACATGTACCCTGGTGAAGATGGTCAGCTCACCTGGTTCAACGCAGGAGTGAGGGTTGGTGTTGGGAAG
GCCTCGGCATGTGCXGTTGGTGTTGGAATTGGGGTGGGACTACTTATGCTTCATATCAGGCAACCACTAGGAATCTGCGGAGGAGGTTTT
TCTAGGCTTCTAACTTTCAGTCATAGTGAAATGGACTTCTTGACTGGATTCAACTACTGGAAAAAGGACTTTATGGTCATTAAAGTAGGT
CTCATCTTAGTGGCAGCAGGCAAAGXGGAGACCCCTAGTGCTGCAGCTGAAGAGTGG
Edits in Original Sequence 
TTTTAATCCTTTCTCTCGCCATGTTCACACATAACGAAACATCTACACTATTTCTCAACCGATCCATGTGTGATTTTTATGGATCCTTAA
CCTTGAATTTTGTTCAATTCTCCTTGTTAATCAATGATCAATTTCCTTCAATTTTTGTAGATTGAAGAAAAAATTGGGATTA
(5')ATGG
GTAATCAAGGTCAGGATATGTCAATGGCAATCTACAAAAACTCGAATTTCACCGGAGGTTGTTTGGAAATCCGATTGTTTTATGTACGTA
TCACGCCATGCGCGGTTGAAACCGTACCGGACCACCTCATACTCCGCCACCTCCGCCGTGAGATGGGGGTAACGTTAGAGATCAACAGTT
CGCGTATTCCGGCTAATGATACAGGCATCATAACCCTCCGACGTGATCGGGTTGATAAGGAATCGTCGGAGGTAACGTTTGTGAGCACGG
ACAGCGTTAGGGTTTCAGGGCCGGTGGAATTTGAGGTACATGAGAATGAAAATGAGTTAATACTTTGTGGGTCGTTGGAGAGAGTAGAGA
CAACGTGGGCTAATGGTAATGTTTTAGAGAATGATTCGAGGAGTGGATGGAGCATGGATTGTTACACAGCAGCATCATTTGGGAATGGTG
GATCAGCTTTTTTTCAGCCTAAATTTGGGGTTTCTTTACCATCAATCGAGGTATACATAGCGGGTTGCTGTTCAGGTGTCCCTGTGATTC
TATCAAAGACAATTCAGGTCAGCCCGAGAAGGAAGTTACCTAGGCAGGGTATGTTGGATGCAATTCCAGAGGATGAGGAGGTTGCGAAGG
AGCAGGGGAGCTCGAATGGATTCGGACGACAAATAAAACCATTGACCACAGAGGATATGGACGATTATGAGGTGGAGCAGAAGGCTGGAT
ATGGTTTCTATTCAGACGACATGTACCCTGGTGAAGATGGTCAGCTCACCTGGTTCAACGCAGGAGTGAGGGTTGGTGTTGGGAtAGGCC
TCGGCATGTGCXGTTGGTGTTGGAATTGGGGTGGGACTACTTATGCgTTCATATCAGGCAACCACTAGGAATCTGCGGAGGAGGTTTTTC
TAGGCTTCTAACTTTCAGTCATAGTGAAATGGACTTCTTGACTGGATTCtAACTACTGGAAAAAGGACTTTATGGTCATTAAAGTAGGTC
TCATCTTAGTGGCAGCAGGCAAAGXGGAGACCCCTAGTGCTGCAGCTGAAGAGTGG(3')TTACGTATTAGGTGGTGTGAGGCTGTAACG
CAATTCAGTATCCTTGTACAGAAGCTGCAGACGACGTTCATCCAAGGATCATCTGTGTTGAGATTATACAAAAGCCCCCAGGCTGAAAAT
CGGTGTTAGTGTGTTCATATGCTGTATTTAAACTAAATATCTCGTATACATGTCCTTTTTTTCTTCTTTTTTTCTTTCGGGTTGGTTTAA
ACTCATCAGCTTTGCTGTTGGTGTGTGCTGAAGTTTGTTATTAAGGTTAGCTTTAGAGAGTTGACAATGCGGCCGACAATTTTGGTAGTT
GCAATAGGTGCTTCGGCGTAACAAATTTAGTTTGTAAAAGTACTCGGCAAATTGTTTCTATAACAGCTTGTTTTGAAGGGTTGTAGCATA
TTGTTGTACAGATGTATCGTGTTGTATTGCATTGTATTACTTTGATAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan