ESTScan Details for Unigene SGN-U324717

Score 
152
Direction 
Forward
Predicted Peptide Sequence 
MSKGNSQLRYFTLILQIIFLQTSNAWKINCPDSACGDIRSIKYPFHLNTDPKHCRVFSGFELACEGNQTVIWLSSKKLHVQGIDYANNTI
HLVDPTLQTHDLCSLLPSKLNFQQYGNFFCRYYYASRYRVATPIFMFNCPSGVDDSTFVEISGCKSSKYTYLKIGEMKVSQVSDGCKAEF
IGLTSWPNINNISYSNIHQAILYGFEFPYSSEWVSSVVSRVLGSEICDXPSVGNCISGVQFKKEHFVMYDTIERF
Predicted Coding Sequence 
ATGTCTAAAGGAAACTCTCAGCTTAGATATTTCACATTAATCCTTCAAATCATATTTCTGCAAACATCCAATGCTTGGAAGATCAACTGT
CCTGATTCTGCCTGTGGCGATATCCGTAGCATAAAATACCCTTTTCATTTAAACACTGATCCAAAACATTGTCGTGTTTTTTCAGGATTT
GAATTAGCTTGTGAAGGTAACCAAACCGTTATATGGTTATCCTCCAAGAAGTTGCATGTTCAAGGCATCGACTATGCTAATAACACAATT
CATTTGGTAGATCCGACTTTACAAACACATGATCTATGCTCTCTCCTACCTTCTAAGCTTAACTTTCAACAATACGGTAATTTCTTCTGT
CGATACTATTATGCATCACGGTATAGAGTAGCCACGCCCATTTTCATGTTCAATTGTCCATCTGGTGTTGATGATTCGACATTTGTGGAA
ATTAGCGGCTGCAAATCAAGCAAATACACTTACCTAAAGATTGGAGAAATGAAAGTCTCTCAAGTGAGTGATGGATGCAAAGCGGAGTTT
ATAGGCTTAACCTCATGGCCTAATATTAACAACATTTCCTATTCTAATATTCATCAAGCAATTCTCTACGGATTTGAGTTTCCTTATTCT
TCXGAGTGGGTTTCTTCCGTTGTTTCCCGTGTATTGGGGAGCGAAATTTGTGATANGCCTTCCGTTGGTAATTGCATTTCTGGTGTACAA
TTCAAAAAGGAGCATTTTGTCATGTACGATACGATTGAACGCTTC
Edits in Original Sequence 
AACCCTGAGTAATACACAAAAA(5')ATGTCTAAAGGAAACTCTCAGCTTAGATATTTCACATTAATCCTTCAAATCATATTTCTGCAAA
CATCCAATGCTTGGAAGATCAACTGTCCTGATTCTGCCTGTGGCGATATCCGTAGCATAAAATACCCTTTTCATTTAAACACTGATCCAA
AACATTGTCGTGTTTTTTCAGGATTTGAATTAGCTTGTGAAGGTAACCAAACCGTTATATGGTTATCCTCCAAGAAGTTGCATGTTCAAG
GCATCGACTATGCTAATAACACAATTCATTTGGTAGATCCGACTTTACAAACACATGATCTATGCTCTCTCCTACCTTCTAAGCTTAACT
TTCAACAATACGGTAATTTCTTCTGTCGATACTATTATGCATCACGGTATAGAGTAGCCACGCCCATTTTCATGTTCAATTGTCCATCTG
GTGTTGATGATTCGACATTTGTGGAAATTAGCGGCTGCAAATCAAGCAAATACACTTACCTAAAGATTGGAGAAATGAAAGTCTCTCAAG
TGAGTGATGGATGCAAAGCGGAGTTTATAGGCTTAACCTCATGGCCTAATATTAACAACATTTCCTATTCTAATATTCATCAAGCAATTC
TCTACGGATTTGAGTTTCCTTATTCTTCXGAGTGGGTTTCTTCCGTTGTTTCCCGTGTATTGGGGAGCGAAATTTGTGATANGCCTTCCG
TTGGTAATTGCATTTCTGGTGTACAATTCAAAAAGGAGCATTTTGTCATGTACGATACGATTGAACGCTTC(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan