ESTScan Details for Unigene SGN-U324729

Score 
696
Direction 
Forward
Predicted Peptide Sequence 
FLKCLVVSVXVHVPHVRRDKLDKKAMAIIGIHVAYSEVSKAYKVYHPQTKKMTITRDVHFSENESGTGRTLINQEVAXLEANISPPEEQK
TEHWQQELEDDHPVKGRRLLSDIYQRCNVAIYEPAGPVEALQDPKWKKAMEEEISMIEKNKTWVLVNKPEDRKVIGVRWVFRTKLNADSS
INKYKTRLVVKGYAQIYGVDYSDTFSPVARLDTIRLLPAIAAQMDSQIVIRPDPADDMRSTSRHCFSLGSGIFSWSSKKQEIVAQSTAAT
GAVNQVLWLRKIMYDLHVEQKESTSILVDNQAAIAISNNPVFHKKTKHFNIKFYFLREVQQRGEVTLVYTKTLPISKFELLRQKIGXLQY
PKQGGVQGICFEPQ
Predicted Coding Sequence 
TTTCTTAAGTGTTTGGTTGTGTCTGTTXTTGTTCATGTTCCTCATGTTAGACGTGACAAACTTGACAAGAAGGCAATGGCAATCATAGGC
ATCCATGTGGCTTACAGTGAAGTTTCTAAAGCCTACAAGGTCTATCATCCTCAGACAAAGAAGATGACAATTACAAGAGATGTTCATTTT
AGTGAGAATGAAAGTGGGACTGGAAGAACTCTCATAAATCAGGAAGTCGCTXCTCTAGAAGCAAACATCAGTCCTCCTGAAGAGCAAAAA
ACAGAACACTGGCAGCAAGAACTAGAAGATGATCATCCAGTCAAGGGGAGGAGGTTGTTGTCAGATATCTATCAGAGGTGTAATGTCGCC
ATCTATGAACCTGCTGGTCCCGTAGAAGCTTTGCAAGACCCAAAATGGAAGAAAGCAATGGAGGAGGAGATCTCCATGATTGAGAAAAAT
AAAACTTGGGTGCTGGTAAACAAACCTGAAGATAGAAAAGTCATTGGTGTGAGATGGGTCTTCAGAACAAAGTTAAATGCAGATAGTTCC
ATCAACAAATACAAGACGAGGCTTGTAGTTAAAGGGTATGCACAAATTTATGGTGTCGATTACTCTGACACCTTTTCTCCTGTTGCAAGA
TTAGACACAATCAGGTTGCTACCCGCAATAGCAGCACAAATGGATTCTCAGATAGTGATTAGGCCAGATCCXGCAGATGATATGAGAAGT
ACCTCTCGCCATTGTTTCAGCCTAGGTTCAGGAATATTCTCATGGTCATCTAAGAAACAGGAAATTGTTGCACAATCAACAGCAGCAACA
GGAGCAGTAAACCAAGTCTTGTGGCTTAGAAAGATCATGTATGATTTACATGTGGAACAGAAGGAAAGTACTAGCATTCTTGTCGACAAC
CAGGCAGCTATTGCAATCTCAAACAATCCGGTGTTTCACAAGAAGACCAAGCATTTCAACATCAAGTTCTATTTTCTGAGAGAAGTACAG
CAAAGGGGAGAAGTAACTCTAGTCTATACTAAGACTTTACCGATCAGCAAATTCGAGCTTCTTAGACAGAAAATTGGAGXTTTGCAGTAT
CCAAAGCAAGGAGGAGTGCAAGGAATCTGTTTTGAACCGCAGTAA
Edits in Original Sequence 
(5')TTTCTTAAGTGTTTGGTTGTGTCTGTTXTTGTTCATGTTCCTCATGTTAGACGTGACAAACTTGACAAGAAGGCAATcGGCAATCA
TAGGCATCCATGTGGCTTACAGTGAAGTTTCTAAAGCCTACAAGGTCTATCATCCTCAGACAAAGAAGATGACAATTACAAGAGATGTTC
ATTTTAGTGAGAATGAAtAGTGGGACTGGAAGAACTCTCATAAATCAGGAAGTCGCTXCTCTAGAAGCAAACATCAGTCCTCCTGAAGAG
CAAAAAACAGAACACTGGCAGCAAGAACTAGAAGATGATCATCCAGTCAAGGGGAGGAGGTTGTTGTCAGATATCTATCAGAGGTGTAAT
GTCGCCATCTATGAACCTGCTGGTCCCGTAGAAGCTTTGCAAGACCCAAAATGGAAGAAAGCAATGGAGGAGGAGATCTCCATGATTGAG
AAAAATAAAACTTGGGTGCTGGTAAACAAACCTGAAGATAGAAAAGTCATTGGTGTGAGATGGGTCTTCAGAACAAAGTTAAATGCAGAT
AGTTCCATCAACAAATACAAGACGAGGCTTGTAGTTAAAGGGTATGCACAAATTTATGGTGTCGATTACTCTGACACCTTTTCTCCTGTT
GCAAGATTAGACACAATCAGGTTGCTACCCGCAATAGCAGCACAAATGGATTCTCAGATAGTGATTAGGCCAGATCCXGCAGATGATATG
AGAAGTACCTCTCGCCATTGTTTCAGCCTAGGTTCAGGAATATTCTCATGGTCATCTAAGAAACAGGAAATTGTTGCACAATCAACAGCA
GCAACAGGAGCAGTAAACCAAGTCTTGTGGCTTAGAAAGATCATGTATGATTTACATGTGGAACAGAAGGAAAGTACTAGCATTCTTGTC
GACAACCAGGCAGCTATTGCAATCTCAAACAATCCGGTGTTTCACAAGAAGACCAAGCATTTCAACATCAAGTTCTATTTTCTGAGAGAA
GTACAGCAAAGGGGAGAAGTAACTCTAGTCTATACTAAGACTTTACCGATCAGCAAATTCGAGCTTCTTAGACAGAAAATTGGAGXTTTG
CAGTATCCAAAGCAAGGAGGAGTGCAAGGAATCTGTTTTGAACCGCAGTAA(3')ATTTAATTTTACTGCCTATGTTTTAAGTTAGACTT
AGTCAATTAGTTGTTAGTCATGCTTTCCTATTATTTANGNNAGTGTTTAGTGACTGCTAGATCATGCATTATTATTAGTGACTGCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan