ESTScan Details for Unigene SGN-U324742

Score 
696
Direction 
Forward
Predicted Peptide Sequence 
VVKEHTWYVGDRVDAWIDYRWREGVIAEKNKRDETTFSVNFPAYGDTAVAEHGISDQALYGKMDSGSNGPGXRHDFLSQGDTPKEKRVKL
GNPASEDTGNSLSKKMDPLVPVTNESATLLPLSVTEKTFDIGSNKDDSKPNTLRTMRSGLHKEGSKVFGVPKPGKKRKFMEVSKHYVSDR
TAKSNAAHGSAKFTKFLMPQATGTGGWKTNSRTDLKEKQQTIETRRKLPKSSKPSSSARTLKDNSITSTRDASGAEHMVGDAIEYDKNEA
QQPNVGNFVSNAGEGVESVKFRSEALPLTSX
Predicted Coding Sequence 
XXAGTTGTTAAGGAGCATACATGGTATGTAGGAGATAGAGTTGATGCATGGATCGACTACCGCTGGCGAGAGGGTGTCATTGCCGAGAAG
AACAAAAGGGACGAGACTACATTTAGTGTCAACTTTCCAGCTTATGGAGATACTGCAGTTGCAGAGCATGGCATCTCCGACCAAGCCTTG
TATGGAAAGATGGATAGTGGGTCGAATGGTCCAGGTXTAAGACATGACTTCTTGTCCCAGGGTGATACACCTAAGGAGAAGCGAGTGAAG
CTGGGCAATCCTGCTAGTGAGGATACTGGAAATAGTCTGTCAAAAAAAATGGATCCACTGGTGCCAGTGACAAATGAATCAGCAACATTG
CTTCCTTTGTCTGTCACTGAAAAAACATTTGATATTGGTAGTAACAAAGATGACAGTAAGCCCAATACACTTAGAACAATGAGGTCTGGT
TTGCACAAAGAGGGATCAAAAGTCTTTGGTGTTCCTAAGCCAGGAAAGAAAAGGAAGTTCATGGAAGTAAGCAAGCACTATGTTTCAGAC
AGAACAGCTAAGAGTAATGCGGCACATGGTTCAGCCAAGTTCACAAAATTTTTGATGCCTCAAGCAACAGGCACTGGTGGATGGAAAACC
AATTCTAGAACTGATTTGAAGGAGAAACAACAAACGATTGAAACTCGACGGAAACTTCCTAAATCAAGTAAGCCTTCAAGCTCAGCTAGA
ACTTTGAAGGATAATAGTATTACATCCACTAGAGATGCTAGTGGAGCTGAGCACATGGTAGGTGATGCAATTGAGTATGATAAGAATGAA
GCACAACAGCCTAATGTGGGGAATTTTGTGTCAAATGCGGGAGAAGGGGTTGAAAGTGTGAAATTTCGTTCAGAAGCTCTTCCACTAACA
TCCCXX
Edits in Original Sequence 
(5')XXAGTTGTTAAGGAGCATACATGGTATGTAGGAGATAGAGTTGATGCATGGATCGACTACCGCTGGCGAGAGGGTGTCATTGCCGA
GAAGAACAAAAGGGACGAGACTACATTTAGTGTCAACTTTCCAGCTTATGGAGATACTGCAGTTGtCAGAGCATGGCATCTCCGACCAAG
CCTTGTATGGAAAGATGGATAGTGGGTCGAATGGTCCAGGTXTAAGACATGACTTCTTGTCCCAGGGTGATACACCTAAGGAGAAGCGAG
TGAAGCTGGGCAATCCTGCTAGTGAGGATACTGGAAATAGTCTGTCAAAAAAAATGGATCCACTGGTGCCAGTGACAAATGAATCAGCAA
CATTGCTTCCTTTGTCTGTCACTGAAAAAACATTTGATATTGGTAGTAACAAAGATGACAGTAAGCCCAATACACTTAGAACAATGAGGT
CTGGTTTGCACAAAGAGGGATCAAAAGTCTTTGGTGTTCCTAAGCCAGGAAAGAAAAGGAAGTTCATGGAAGTAAGCAAGCACTATGTTT
CAGACAGAACAGCTAAGAGTAATGCGGCACATGGTTCAGCCAAGTTCACAAAATTTTTGATGCCTCAAGCAACAGGCACTGGTGGATGGA
AAACCAATTCTAGAACTGATTTGAAGGAGAAACAACAAACGATTGAAACTCGACGGAAACTTCCTAAATCAAGTAAGCCTTCAAGCTCAG
CTAGAACTTTGAAGGATAATAGTATTACATCCACTAGAGATGCTAGTGGAGCTGAGCACATGGTAGGTGATGCAATTGAGTATGATAAGA
ATGAAGCACAACAGCCTAATGTGGGGAATTTTGTGTCAAATGCGGGAGAAGGGGTTGAAAGTGTGAAATTTCGTTCAGAAGCTCTTCCAC
TAACATCCCXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan