ESTScan Details for Unigene SGN-U324777

Score 
283
Direction 
Forward
Predicted Peptide Sequence 
WMVVVLGVALVIHEAGAEDECSTVTALVSACASFVNYGTPDPVPGAPCCIAMTTLSTVASSTGVQTRQSVCRCMMELITTYNPNATAIAT
LPGFCGVSLGFTIEPNTDCXIRLGQIGVWKVMLKNKHHLHSNKKEQPYRNSSYVVFNIVVQRETKQRLPXNDKYDVNNT
Predicted Coding Sequence 
XXTTGGATGGTGGTGGTTTTGGGGGTTGCTTTAGTAATTCATGAAGCTGGAGCTGAAGATGAATGCAGCACAGTGACAGCACTGGTATCG
GCATGTGCCAGCTTCGTGAACTATGGCACACCAGATCCGGTACCTGGTGCACCATGTTGCATTGCTATGACTACCCTAAGTACTGTAGCT
AGCTCCACTGGCGTTCAGACCCGCCAGTCTGTCTGTAGATGCATGATGGAGCTTATTACTACTTACAACCCAAATGCTACTGCCATTGCC
ACTCTGCCTGGTTTCTGTGGTGTTTCTCTTGGTTTCACCATTGAACCTAACACTGATTGTGAXATTCGTCTCGGACAAATTGGTGTTTGG
AAAGTGATGCTGAAGAACAAGCACCATCTTCACTCTAATAAAAAAGAGCAACCTTACAGGAACAGTTCGTATGTTGTTTTTAATATAGTT
GTCCAAAGGGAAACTAAACAAAGACTTCCTXTTAATGACAAGTATGATGTGAATAACACTTAA
Edits in Original Sequence 
(5')XXTTGGATGGTGGTGGTTTTGGGGGTTGCTTTAGTAATTCATGAAGCTGGAGCTGAAGATGAATGCAGCACAGTGACAGCACTGGT
ATCGGCATGTGCCAGCTTCGTGAACTATGGCACACCAGATCCGGTACCTGGTGCACCATGTTGCATTGCTATGACTACCCTAAGTACTGT
AGCTAGCTCCACTGGCGTTCAGACCCGCCAGTCTGTCTGTAGATGCATGATGGAGCTTATTACTACTTACAACCCAAATGCTACTGCCAT
TGCCACTCTGCCTGGTTTCTGTGGTGTTTCTCTTGGTTTCACCATTGAACCTAACACTGATTGTGAXATTCGTCTCGtGACAAATTGGTG
TTTGGAAAGTGATGCTGAAGAACAAGCACgCATCTTCACTCTAATAAAAAAGAGCAACCTTACAGGAACAGTTCGTATGTTGTTTTTAAT
ATAGTTGTCCAAAGGGAAACTAAACAAAGACTTCCTXTTAATGACAAGTATGATGTGAATAACACTTAA(3')AGATTGCTCCAAAAAAA
AAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan