ESTScan Details for Unigene SGN-U324885

Score 
227
Direction 
Reverse
Predicted Peptide Sequence 
MAWLSQLDNFQEQTDQDSEISVSIGFLSMDGGGSAIAAFVKLAAFEETRSHRQLFLQNNWKKRLVEPSPNDFRSAGFTKDLHRGHVLSLS
NHSDTQSSQNICLQRSKIGVCIFSWQIAQRSPAALPEINDIVLELQKHLKKTIQLISPIFAENFLQGLLLISHLKKTVTALVALFSFNDK
GKPAAATLWVHTEKNPAPMQLLANNKERYPTLGKPDADELDPEGKPLALLARGFKLETSNMEVPYPNHWATLKDTTLAFAQLNSSALELF
QHHIMY
Predicted Coding Sequence 
ATGGCCTGGTTGAGCCAATTAGACAACTTTCAGGAGCAAACAGATCAGGATTCTGAAATAAGTGTGTCAATAGGCTTTCTTTCCATGGAT
GGGGGGGGTTCAGCTATAGCTGCTTTTGTGAAGTTGGCAGCTTTTGAAGAGACTCGCTCTCATCGACAATTATTTCTTCAGAATAACTGG
AAAAAGAGACTAGTTGAACCGTCACCAAATGATTTTAGATCGGCAGGTTTTACTAAAGACCTGCACAGAGGGCACGTCCTTTCCCTCTCG
AACCATTCAGACACACAGTCTTCACAGAATATATGTTTACAACGTAGTAAGATTGGTGTATGCATTTTCTCCTGGCAAATAGCACAGAGA
TCCCCAGCAGCATTGCCTGAAATTAATGATATTGTCCTAGAGCTTCAGAAGCACTTAAAGAAAACAATTCAGTTAATAAGTCCAATATTT
GCTGAAAACTTTTTACAAGGATTATTATTGATTTCTCATCTTAAAAAGACCGTTACAGCTCTGGTAGCTCTTTTTTCTTTTAATGACAAG
GGXAAACCAGCAGCTGCTACCCTTTGGGTGCACACAGAAAAAAACCCCGCTCCTATGCAATTGCTCGCAAACAACAAAGAGAGGTACCCC
ACACTAGGCAAGCCTGATGCXGATGAGCTCGACCCAGAAGGCAAACCCCTTGCTTTGCTGGCAAGGGGTTTCAAACTTGAAACCTCCAAC
ATGGAAGTCCCATACCCAAACCACTGGGCCACCCTAAAGGACACAACTCTAGCTTTTGCCCAACTCAATTCAAGTGCACTTGAATTATTC
CAACACCACATCATGTACTAA
Edits in Original Sequence 
TTTTTTTTTTTTTTTTTTTTATGCACTGCGGATATGACTTAAATGATGGTCCCAAAAATCTTCGAGCCAACCAAGACTATGCTTTTTTCC
AAAAGATGCCAGCTTGTTTTTACATATAGGCACAAATAAGCATTTTTCTGTATAGGTTTGTTTAGGGGATGAAACCTAACTGGCCATGGG
GATAAAAAGATATATATATATCTGACTACAACACTATTTTCATACATTGTACACTTGACAATTCTGTGGATTAATAGACTGATACAAACA
TTTTCTCCGAGCAAACGTATGAACAATAGCCTGCTCCATGTGTGGAACTGTGTATAAACA
(5')ATGGCCTGcGTTGAGCCAATTAGACA
ACTTTCAGGAGCAAACAGATCAGGATTCTGAAATAAGTGTGTCAATAGGCTTTCTTTCCATGGATGGGGGGGGTTCAGCTATAGCTGCTT
TTaGTGAAGTTGGCAGCTTTTGAAGAGACTCGCTCTCATCGACAATTATTTCTTCAGAATAACTGGAAAAAGAGACTAGTTGAACCGTCA
CCAAATGATTTTAGATCGGCAGGTTTTACTAAAGACCTGCACAGAGGGCACGTCCTTTCCCTCTCGAACCATTCAGACACACAGTCTTCA
CAGAATATATGTTTACAACGTAGTAAGATTGGTGTATGCATTTTCTCCTGGCAAATAGCACAGAGATCCCCAGCAGCATTGaCCTGAAAT
TAATGATATTGTCCTAGAGCTTCAGtAAGCACTTAAAGAAAACAATTCAGTTAATAAGTCCAATATTTGCTGAAAACTTTTTACAAGGAT
TATTATTGATTTCTCATCTTAAAAAGACCGTTACAGCTCTGGTAGCTCTTTTTTCTTTTAATGACAAGGGXAAACCAGCAGCTGCTACCC
TTTGGGTGCACACAGAAAAAAACCCCGCTCCTATGCAATTGCTCGCAAACAACAcAAGAGAGGTACCCCACACTAGGCAAGCCTGATGCX
GATGAGCTCGACCCAGAAGGCAAACCCCTTGCTTTcGCTGGCAAGGGGTTTCAAACTTGAAACCTCCAACATGGAAGTCCCATACCCAAA
CCACTGGGCCACCCTAAAGGACACAACTCTAGCTTTTGCCCAACTCAATTCAAGTGCACTTGAATTATTCCAACACCACATCATGTACTA
A(3')ACAGTATACTCTTTCTTAAAAAAATAGCTTCTACGATACAAAAGTTACTCCAAATTTCACATTCGAGGTATTTTCTTTTTCTTTT
GTTTCTTAATTTTTCTTTTCAATAAGCTAACACTTAAAGTCCTCCGTGGAGCTTCCCAAACATGTAAATATCAGTGTTTGC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan