ESTScan Details for Unigene SGN-U324945

Score 
298
Direction 
Forward
Predicted Peptide Sequence 
KYRPKIADFGLARVNIREKGSAPLVIAGTFGYMAPEYLAQGQLSDKVDVYSFGVLILEIVSGQEFNKVPADDTLDTLVTIAWKHFKEKRA
YRIIDPSMEIEDVNEVLRVVQIALLCTQESPIMRPDMSTIIKLLTQKNIEVPVPSKPPFIDDSEQHGSIHQHHPSASSVDSCRYYDTHQD
NGSFHRYRHHPSASIDSYYDTESVLDDNGAXLYGLSAKTELASISHTAGSDNFGDYYEAIRVX
Predicted Coding Sequence 
XXGAAATATCGTCCCAAAATTGCAGATTTTGGTCTTGCCAGGGTTAATATCAGGGAAAAAGGAAGTGCACCTCTTGTCATTGCAGGCACA
TTCGGATACATGGCTCCAGAGTACCTTGCTCAAGGACAATTATCAGACAAAGTGGATGTTTATAGCTTTGGAGTTCTTATCCTGGAAATA
GTAAGCGGACAGGAGTTCAACAAAGTTCCAGCCGATGACACTCTAGACACCCTAGTAACCATTGCTTGGAAACATTTCAAGGAGAAAAGG
GCATATCGGATAATAGATCCGAGCATGGAAATAGAAGATGTGAATGAAGTACTAAGGGTGGTTCAAATTGCGCTGCTATGTACTCAAGAG
TCACCTATTATGCGTCCAGATATGTCAACAATCATTAAACTACTTACACAAAAAAACATAGAAGTGCCTGTTCCTTCAAAGCCTCCTTTC
ATTGATGATTCCGAACAACATGGCTCTATTCATCAGCATCATCCCTCTGCATCATCAGTTGATTCTTGCAGATATTATGACACACACCAA
GACAATGGCTCTTTTCATCGTTATCGTCATCATCCTTCTGCATCAATTGATTCTTATTACGACACGGAAAGTGTTTTGGATGACAATGGT
GCTXCTCTTTATGGTCTATCTGCAAAGACAGAGCTAGCCTCTATTTCACACACAGCTGGATCAGATAATTTTGGAGATTATTACGAAGCT
ATCCGCGTTAAX
Edits in Original Sequence 
(5')XXGAAATATCGTCCCAAAATTGCAGATTTTGGTCTTGCCAGGGTTAATATCAGGGAAAAAGGAAGTGCACCTCTTGTCATTGCAGG
CACATTCGGATACATGGCTCCAGAGTACCTTGCTCAAGGACAATTATCAGACAAAGTGGATGTTTATAGCTTTGGAGTTCTTATCCTGGA
AATAGTAAGCGGACAGGAGTTCAACAAAGTTCCAGCCGATGACACTCTAGACACCCTAGTAACCATTGCTTGGAAACATTTCAAGGAGAA
AAGGGCATATCGGATAATAGATCCGAGCATGGAAATAGAAGATGTGAATGAAGTACTAAGGGTGGTTCAAATTGCGCTGCTATGTACTCA
AGAGTCACCTATTATGCGTCCAGATATGTCAACAATCATTAAACTACTTACACAAAAAAACATAGAAGTGCCTGTTCCTTCAAAGCCTCC
TTTCATTGATGATTCCGAACAACATGGCTCTATTCATCAGCATCATCCCTCTGCATCATCAGTTGATTCTTGCAGATATTATGACACACA
CCAAGACAATGGCTCTTTTCATCGTTATCGTCATCATCCTTCTGCATCAATTGATTCTTATTACGACACGGAAAGTGTTTTaGGATGACA
ATGGTGCTXCTCTTTATGGTCTATCTGCAAAGACAGAGCTAGCCTCTATTTCACACACAGCTcGGATCAGATAATTTTGGAGATTATTAC
GAAGCTATCCGCGTgTAAX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan