ESTScan Details for Unigene SGN-U324977

Score 
952
Direction 
Forward
Predicted Peptide Sequence 
MELVERRGRQQQRQEEKGAFERKSSREKSTRRRMTISIVEEEEEEEEESPKIVDLSGMSLDFIPVNPTINLGAISKLHISNNNLQSIPES
LTARLLNLVELDMHSNQLNSIPNSIGCLSKLKLLNISGNLLLSLPKTIENCRALEELNANFNMLTHLPDTIGFELINLKKLCINSNKIAH
LPYSTSHLTNLRVLDARLNCLRSLPDDLENLINLEILNVSQNFQYLSKLPYSVGFLISLHELDVSYNKITELPDSIGCLKKLQKLSVEGN
RLVSPPPEVVEQGIRAVKQYLCEKINGMHDKSPKKKSWFGKLARCSTFSGANLPRDDFGVPSNRTIDAIASPRFIAMLSPRRLLSPKTYF
SK
Predicted Coding Sequence 
ATGGAATTAGTTGAACGACGAGGACGACAACAACAACGACAAGAAGAAAAAGGAGCATTTGAGAGGAAGAGTAGTAGGGAAAAAAGTACA
AGAAGAAGGATGACAATTAGTATTGTAGAAGAAGAAGAAGAAGAAGAAGAAGAGAGCCCTAAGATTGTGGATCTAAGTGGCATGTCATTG
GATTTTATTCCTGTAAATCCTACTATAAATTTGGGAGCTATATCCAAATTACATATTTCCAACAATAATCTTCAGAGTATACCAGAGTCT
TTAACAGCAAGACTACTAAACTTGGTTGAGTTAGATATGCACTCAAATCAGCTCAACTCCATTCCTAACTCAATAGGTTGCTTATCGAAG
CTCAAACTTCTCAACATTTCTGGGAATCTCCTTCTTTCGCTCCCTAAAACTATCGAGAATTGCAGAGCATTGGAAGAGTTGAATGCCAAT
TTCAATATGCTTACTCATTTACCGGACACGATTGGATTTGAGCTCATAAATCTGAAGAAGCTATGCATAAATTCAAATAAAATAGCACAT
CTTCCTTACTCCACCTCCCACTTGACTAACCTTCGCGTGTTAGATGCTAGGCTAAACTGCCTTAGATCACTCCCCGATGATCTTGAAAAC
CTAATCAACCTTGAAATCCTCAACGTTAGCCAAAATTTTCAGTACCTATCAAAGTTGCCCTATTCAGTAGGTTTTCTCATTTCTCTACAC
GAACTAGATGTTAGTTACAACAAAATTACTGAATTACCAGATTCCATCGGATGCTTGAAGAAGCTCCAAAAGCTAAGTGTTGAAGGCAAC
CGCCTTGTTTCTCCTCCACCGGAGGTAGTGGAGCAAGGGATACGTGCAGTTAAGCAATACTTGTGTGAAAAGATCAACGGTATGCATGAC
AAGTCCCCTAAGAAGAAGTCATGGTTTGGAAAGTTAGCAAGATGTAGCACATTTAGTGGTGCTAACCTACCAAGAGATGACTTTGGTGTT
CCAAGCAATCGCACTATCGATGCAATTGCCTCACCAAGATTTATAGCCATGCTTTCTCCTCGTCGTCTTCTATCTCCAAAAACCTACTTC
TCCAAATAA
Edits in Original Sequence 
CTATGTGTTTGTGTCACCACACACAAGTAACGACCCCTCAATTTGTCAATAAACAAATAAGAGGAGTTGTTGATTATCAAAGGAAGAAGA
AGAAGATTATGAAATTTCAATGATGATTTGTGTTAGGGTTAAGAGATTATGAAGATGAGA
(5')ATGGAATTAGTTGAACGACGAGGACG
ACAACAACAACGACAAGAAGAAAAAGGAGCATTTGAGAGGAAGAGTAGTAGGGAAAAAAGTACAAGAAGAAGGATGACAATTAGTATTGT
AGAAGAAGAAGAAGAAGAAGAAGAAGAGAGCCCTAAGATTGTGGATCTAAGTGGCATGTCATTGGATTTTATTCCTGTAAATCCTACTAT
AAATTTGGGAGCTATATCCAAATTACATATTTCCAACAATAATCTTCAGAGTATACCAGAGTCTTTAACAGCAAGACTACTAAACTTGGT
TGAGTTAGATATGCACTCAAATCAGCTCAACTCCATTCCTAACTCAATAGGTTGCTTATCGAAGCTCAAACTTCTCAACATTTCTGGGAA
TCTCCTTCTTTCGCTCCCTAAAACTATCGAGAATTGCAGAGCATTGGAAGAGTTGAATGCCAATTTCAATATGCTTACTCATTTACCGGA
CACGATTGGATTTGAGCTCATAAATCTGAAGAAGCTATGCATAAATTCAAATAAAATAGCACATCTTCCTTACTCCACCTCCCACTTGAC
TAACCTTCGCGTGTTAGATGCTAGGCTAAACTGCCTTAGATCACTCCCCGATGATCTTGAAAACCTAATCAACCTTGAAATCCTCAACGT
TAGCCAAAATTTTCAGTACCTATCAAAGTTGCCCTATTCAGTAGGTTTTCTCATTTCTCTACACGAACTAGATGTTAGTTACAACAAAAT
TACTGAATTACCAGATTCCATCGGATGCTTGAAGAAGCTCCAAAAGCTAAGTGTTGAAGGCAACCGCCTTGTTTCTCCTCCACCGGAGGT
AGTGGAGCAAGGGATACGTGCAGTTAAGCAATACTTGTGTGAAAAGATCAACGGTATGCATGACAAGTCCCCTAAGAAGAAGTCATGGTT
TGGAAAGTTAGCAAGATGTAGCACATTTAGTGGTGCTAACCTACCAAGAGATGACTTTGGTGTTCCAAGCAATCGCACTATCGATGCAAT
TGCCTCACCAAGATTTATAGCCATGCTTTCTCCTCGTCGTCTTCTATCTCCAAAAACCTACTTCTCCAAATAA(3')AGGACATTGCAAC
TTGCTTGGAGATATCATAGTGTGTTTAGCTCTTAGTTTGTTTTCTTTTACGTTTTGAAATCGTGCAAATGTGTGCTTAGATCAAGTTGTA
CATTATGTCCTGTAGAATTTGTTGTCTTTGAGATTGTACACATCATTTTCATAGATGAAGTATGAATTTACTCAAAAAAAAAAAAAAAAA
GGAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan