ESTScan Details for Unigene SGN-U325085

Score 
554
Direction 
Forward
Predicted Peptide Sequence 
MEPANLGNLRGSSLRGSISGSRRGSVSLRANSNSIWRNTGVEIFSRSARDEDDEEALKWAALEKLPTFDRLRKGLLFGSQGAAAEIDIDD
IGLQERKNLLERLVRVADEDNEKFLLKLKNRIDRYXSSLFDSNLAFES
Predicted Coding Sequence 
ATGGAGCCTGCAAATTTGGGTAATTTGAGAGGTAGTAGTTTAAGAGGAAGTATAAGTGGAAGTAGAAGAGGAAGTGTAAGCTTAAGAGCA
AATAGTAATTCCATATGGAGAAATACTGGGGTTGAGATATTTTCAAGATCAGCTAGAGATGAAGATGATGAAGAAGCATTAAAATGGGCA
GCACTTGAAAAATTACCAACTTTTGATAGATTAAGAAAAGGTTTATTGTTTGGTTCACAAGGTGCTGCTGCTGAAATTGATATTGATGAT
ATTGGTTTACAAGAAAGAAAAAATTTACTTGAAAGACTTGTTAGAGTTGCTGATGAAGATAATGAAAAGTTCTTGTTGAAACTCAAAAAC
AGGATTGATAGGTATGXTTCATCTTTGTTTGATTCAAATCTCGCGTTCGAATCCTGA
Edits in Original Sequence 
TTCACAACCAAAAAAAAAAAAAAAAAATTCTTTTGAATTTTTTTTAACAACCCCATTTTCTAATTTGTGATGATTTGAAGTTTTTCTTAG
TTAATTTTTGAAAAAAAATTGAATCTTGATTTTTGTTTTTTTAATTTTAAGAATTTGGGGTTTCCAAAAA
(5')ATGGAGCCTGCAAATT
TGGGTAATTTGAGAGGTAGTAGTTTAAGAGGAAGTATAAGTGGAAGTAGAAGAGGAAGTGTAAGCTTAAGAGCAAATAGTAATTCCATAT
GGAGAAATACTGGGGTTGAGATATTTTCAAGATCAGCTAGAGATGAAGATGATGAAGAAGCATTAAAATGGGCAGCACTTGAAAAATTAC
CAACTTTTGATAGATTAAGAAAAGGTTTATTGTTTGGTTCACAAGGTGCTGCTGCTGAAATTGATATTGATGATATTGGTTTACAAGAAA
GAAAAAATTTACTTGAAAGACTTGTTAGAGTTGCTGATGAAGATAATGAAAAGTTCTTGTTGAAACTCAAAAACAGGATTGATAGGTATG
XTTCATCTTTGTTTGATTCAAATCTCGCGTTCGAATCCTGA(3')ATATTAAATACTTGTACTATTTTCTTCCGACCCCACTTTGTGAAA
CTACACTGAACTTGTAGTTGTTGTTGGGTGGGAAGTTAAATTTTGTTTTTTTTAATGGTTACCATAGATGTTGTCTACGATTCATATTGA
ATCCGACTTATTTGGATTCACATAGTATAAGTCGGAAATGTCTTTATATAAGGATTTTTTTTTATATTCAGAGTGAAAAAAAAAAAAAAA
AAAAAACTCGAGGGGGGCCCGGTCCCAATG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan