ESTScan Details for Unigene SGN-U325112

Score 
746
Direction 
Forward
Predicted Peptide Sequence 
NSLLIDLHFLIKCSAEWGREVYTLYIQGKEKRGALFKNWDMSWSSDPDNHRKYKYEIVEIVSDYVVDVGVLVGYLDKVSRFVSLFQRMRP
TEVGTFFVKPNELYKFSHQIPSFKMTGTEREGVPAGSFELDPASLPLSPDDIWYPGKVMEDSRAVNSEPVENDLPAVPLGARDKSRKATT
SLKSGDDIHATDGESSKVQITPKKMNISEKKRTQMSSSSANDSPSTDFDDNCVKKSRHSSPRMPIHLSCQGDRELHSCRKSFGLSNSVGS
SKKISTFSVDKGFEETFCDFEMDRSTGKFQINQVWAIYGQNST
Predicted Coding Sequence 
XTGAATTCACTTCTGATCGACTTACATTTTCTCATCAAGTGCAGTGCGGAATGGGGAAGAGAGGTCTATACATTGTATATCCAAGGAAAG
GAGAAACGTGGXGCCCTTTTCAAAAATTGGGATATGAGTTGGAGCTCTGATCCAGATAATCATAGGAAGTACAAGTATGAAATTGTGGAG
ATAGTTTCTGATTATGTTGTGGATGTTGGTGTTCTTGTTGGTTATTTAGATAAAGTTTCCAGATTTGTTAGCCTTTTCCAGCGAATGAGG
CCGACTGAAGTTGGTACATTCTTTGTAAAGCCAAATGAACTTTACAAGTTCTCTCATCAAATTCCTTCTTTTAAAATGACTGGAACTGAA
CGAGAGGGTGTACCTGCGGGATCCTTTGAACTTGATCCTGCTTCTTTACCCCTCAGTCCTGATGATATTTGGTACCCTGGAAAAGTTATG
GAAGACAGCAGGGCGGTTAATTCTGAACCTGTAGAAAATGATCTACCTGCAGTTCCACTTGGAGCTAGAGATAAATCAAGGAAAGCAACA
ACATCTCTGAAGTCTGGGGATGACATCCATGCTACTGATGGAGAGTCTTCCAAGGTTCAAATAACTCCTAAAAAAATGAACATCTCTGAG
AAAAAGCGAACTCAAATGAGCTCTAGTTCTGCCAATGACAGTCCTTCCACTGACTTTGATGATAATTGTGTTAAAAAAAGCCGTCACTCA
AGTCCCCGCATGCCAATTCATTTGTCATGTCAAGGTGATAGAGAGTTGCATTCATGCAGGAAGAGCTTTGGTCTCAGCAACTCCGTTGGA
AGTTCCAAAAAAATATCAACTTTTTCAGTTGATAAAGGTTTTGAAGAAACTTTTTGTGATTTCGAGATGGACAGATCTACAGGGAAGTTT
CAAATAAATCAGGTATGGGCTATTTATGGTCAAAATAGTACA
Edits in Original Sequence 
(5')XTGAATTCACTTCTGATCGACTTACATTTTCTCATCAAGTGCAGTGCGGAATGGGGAAGAGAGGTCTATACATTGTATATCCAAGG
AAAGGAGAAACGTGGXGCCCTTTTCAAAAATTGGGATATGAGTTGGAGCTCTGATCCAGATAATCATAGGAAGTACAAGTATGAAATTGT
GGAGATAGTTTCTGATTATGTTGTGGATGTTGGTGTTCTTGTTGGTTATTTAGATAAAGTTTCCAGATTTGTTAGCCTTTTCCAGCGAAT
GAGGCCGACTGAAGTTGGTACATTCTTTGTAAAGCCAAATGAACTTTACAAGTTCTCTCATCAAATTCCTTCTTTTAAAATGACTGGAAC
TGAACGAGAGGGTGTACCTGCGGGATCCTTTGAACTTGATCCTGCTTCTTTACCCCTCAGTCCTGATGATATTTGGTACCCTGGAAAAGT
TATGGAAGACAGCAGGGCGGTTAATTCTGAACCTGTAGAAAATGATCTACCTGCAGTTCCACTTGGAGCTAGAGATAAATCAAGGAAAGC
AACAACATCTCTGAAGTCTGGGGATGACATCCATGCTACTGATGGAGAGTCTTCCAAGGTTCAAATAACTCCTAAAAAAATGAACATCTC
TGAGAAAAAGCGAACTCAAATGAGCTCTAGTTCTGCCAATGACAGTCCTTCCACTGACTTTGATGATAATTGTGTTAAAAAAAGCCGTCA
CTCAAGTCCCCGCATGCCAATTCATTTGTCATGTCAAGGTGATAGAGAGTTGCATTCATGCAGGAAGAGCTTTGGTCTCAGCAACTCCGT
TGGAAGTTCCAAAAAAATATCAACTTTTTCAGTTGATAAAGGTTTTGAAGAAACTTTTTGTGATTTCGAGATGGACAGATCTACAGGGAA
GTTTCAAATAAATCAGGTATGGGCTATTTATGGTCAAAATAGTACA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan