ESTScan Details for Unigene SGN-U325131

Score 
946
Direction 
Forward
Predicted Peptide Sequence 
LIVSKLNNGAKNKIQIVHVPKANNFTEQRQNHEHILWTKEIQIHMKHITHQKSSSSSSQPNKSMAASLSSLFLSNPRPFRPPINPKSNPH
LVFPLRTLNFSAKPNPPPPNSNAKQPPTIKEPPLPTPPVGDEKKSFAVATGELFLGIASRVLRRGSSLVNGSNEEPAGVTMFKDDEESES
YFLKRRKEGIASVVEDPVQPEVVWEQTEKDVEAEKSLKTVTSPGFSFSAAGLLFPYHLGVAKLLIEKGYIKETTPLAGSSAGAIVCVVVA
SGASMQEALDATKILAQDCRLKGTAFRLGAVLREVLEKFLPDDAHIRCNGRVRVAXNTDTLEAQRLVVDQFDSKEDLINAVFTSSFIPGY
TFLLALLVSLLAQALTKPSKYHESRYLAPRPATFFRNRLCIDGGLTLFMPPTSAAQTVIC
Predicted Coding Sequence 
TTGATCGTCTCCAAACTCAACAATGGAGCAAAGAACAAAATCCAAATAGTTCATGTTCCAAAAGCTAACAATTTTACAGAGCAAAGGCAA
AATCACGAGCATATACTATGGACGAAAGAAATACAAATACATATGAAACATATTACCCATCAAAAATCATCATCTTCTTCTTCTCAACCT
AACAAATCAATGGCTGCTTCACTATCTTCCCTTTTCCTCTCAAACCCTCGTCCTTTTCGCCCTCCTATAAACCCTAAATCTAATCCCCAT
CTCGTTTTTCCACTTCGTACCCTCAATTTCTCCGCTAAACCTAACCCACCCCCTCCGAACTCCAATGCAAAACAACCACCCACCATCAAA
GAACCGCCGTTGCCTACTCCGCCAGTGGGGGATGAGAAGAAGTCGTTTGCGGTGGCGACCGGCGAGCTTTTCCTTGGGATTGCTTCACGA
GTTTTGAGGCGTGGAAGTAGTTTAGTTAATGGGTCGAATGAGGAGCCGGCTGGTGTGACTATGTTCAAGGATGATGAAGAGAGTGAGTCT
TACTTTTTGAAAAGGAGGAAGGAAGGGATAGCGTCGGTGGTTGAGGACCCTGTTCAGCCGGAGGTTGTGTGGGAGCAGACGGAGAAGGAT
GTGGAAGCTGAGAAGAGCTTGAAAACGGTGACTAGCCCTGGGTTTAGCTTCTCTGCTGCTGGGCTTTTGTTTCCCTATCATCTTGGGGTT
GCTAAGCTTCTCATTGAGAAGGGCTATATCAAGGAGACAACACCACTAGCTGGTTCGTCTGCTGGTGCAATTGTCTGTGTAGTGGTTGCT
TCTGGTGCCAGTATGCAAGAGGCTCTAGATGCTACGAAAATATTAGCTCAAGATTGTCGGCTCAAAGGGACAGCATTTCGCCTTGGGGCT
GTTCTTAGAGAAGTTCTAGAGAAATTTCTTCCAGATGATGCTCATATTAGATGCAATGGAAGAGTTCGTGTTGCTGXTAACACAGATACT
TTGGAGGCCCAGAGGCTTGTTGTTGATCAGTTTGATTCAAAGGAAGATCTTATCAATGCTGTCTTTACTTCTTCGTTTATCCCAGGGTAC
ACTTTCCTTCTGGCTTTATTAGTTTCTCTTTTAGCTCAAGCTTTAACTAAACCTTCAAAGTATCATGAATCAAGATATCTTGCTCCGAGA
CCAGCCACGTTTTTCAGGAATAGATTGTGTATTGATGGGGGGCTGACACTGTTTATGCCGCCGACATCTGCTGCTCAGACGGTAATTTGT
TAA
Edits in Original Sequence 
(5')TTGATCGTCTCCAAACTCAACAATGGAGCAAAGAACAAAATCCAAATAGTTCATGTTCCAAAAGCTAACAATTTTACAGAGCAAAG
GCAAAATCACGAGCATATACgTATGGACGAAAGAAATACAAATACATATGAAACATATTACCCATCAAAAATCATCATCTTCTTCTTCTC
AACCTAACAAATCAATGGCTGCTTCACTATCTTCCCTTTTCCTCTCAAACCCTCGTCCTTTTCGCCCTCCTATAAACCCTAAATCTAATC
CCCATCTCGTTTTTCCACTTCGTACCCTCAATTTCTCCGCTAAACCTAACCCACCCCCTCCGAACTCCAATGCAAAACAACCACCCACCA
TCAAAGAACCGCCGTTGCCTACTCCGCCAGTGGGGGATGAGAAGAAGTCGTTTGCGGTGGCGACCGGCGAGCTTTTCCTTGGGATTGCTT
CACGAGTTTTGAGGCGTGGAAGTAGTTTAGTTAATGGGTCGAATGAGGAGCCGGCTGGTGTGACTATGTTCAAGGATGATGAAGAGAGTG
AGTCTTACTTTTTGAAAAGGAGGAAGGAAGGGATAGCGTCGGTGGTTGAGGACCCTGTTCAGCCGGAGGTTGTGTGGGAGCAGACGGAGA
AGGATGTGGAAGCTGAGAAGAGCTTGAAAACGGTGACTAGCCCTGGGTTTAGCTTCTCTGCTGCTGGGCTTTTGTTTCCCTATCATCTTG
GGGTTGCTAAGCTTCTCATTGAGAAGGGCTATATCAAGGAGACAACACCACTAGCTGGTTCGTCTGCTGGTGCAATTGTCTGTGTAGTGG
TTGCTTCTGGTGCCAGTATGCAAGAGGCTCTAGATGCTACGAAAATATTAGCTCAAGATTGTCGGCTCAAAGGGACAGCATTTCGCCTTG
GGGCTGTTCTTAGAGAAGTTCTAGAGAAATTTCTTCCAGATGATGCTCATATTAGATGCAATGGAAGAGTTCGTGTTGCTGXTAACACAG
ATACTTTGGAGGCCCAGAGGCTTGTTgGTTGATCAGTTTGATTCAAAGGAAGATCTTATCAATGCTGTCTTTACTTCTTCGTTTATCCCA
GGGTACACTTTCCTTCTGGCTTTATTAGTTTCTCTTTTAGCTCAAGCTTTAAtCTAAACCTTCAAAGTATCATGAATCAcAGATATCTTG
CTCCGAGACCAGCCACGTTTTTCAGGAATAGATTGTGTATTGATGGGGGGCTGACACTGTTTATGCCGCCGACATCTGCTGCTCAGACGG
TAATTTGTTAA(3')GAAATTAGTCAAATAGTCTGCTGTCATTTGTGGATGCTAGTTGTAGGTTGAATTTGCTATTGTATGTCCTGTGCT
TTGAAATAATTTGA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan