ESTScan Details for Unigene SGN-U325199

Score 
468
Direction 
Forward
Predicted Peptide Sequence 
LNERIXLIIVKEVWRRSPMARSXDGPEAPNVFNVVIEISKGSKVKYELDKKTGLIKVDRXPILINGVPPELWLHSSDFIEDNDPMDVLVL
MQEPVLPGCFLRARAIGLMPMIDQGEKDDKIIAVCADDPEYRHYTDINQLAPHRLAEIRRFFEDYKKLENKEVAVNEFLPPSTAVQAIQY
SMDLYAEYILQTLRK
Predicted Coding Sequence 
TTGAATGAGAGGATTCXTCTCATCATTGTCAAGGAGGTCTGGCGCCGCTCACCCATGGCACGATCTCNAGATGGACCTGAAGCTCCAAAT
GTTTTCAATGTTGTCATTGAGATATCGAAAGGCAGTAAAGTCAAATATGAGCTTGACAAGAAAACTGGTCTCATTAAGGTTGATCGCGXT
CCTATACTCATCAATGGTGTACCCCCAGAACTATGGCTTCATTCCTCGGACTTTATTGAAGATAATGACCCCATGGATGTACTAGTGCTC
ATGCAGGAGCCTGTTCTCCCAGGCTGTTTCCTTCGAGCTAGGGCCATAGGTTTAATGCCTATGATTGATCAGGGTGAGAAGGATGATAAG
ATAATAGCAGTTTGTGCTGACGATCCAGAATATCGCCACTACACTGATATTAACCAGCTTGCTCCTCACCGTCTGGCAGAAATCCGCCGC
TTTTTTGAAGACTACAAGAAGCTTGAGAACAAGGAGGTTGCTGTCAATGAGTTCCTGCCTCCAAGCACTGCTGTCCAAGCCATACAATAT
TCAATGGACCTTTATGCCGAATACATATTACAGACACTGAGAAAGTAA
Edits in Original Sequence 
(5')TTGAATGAGAGGATTCXTCTCATCATTGTCAAGGAGGTCTGGCGCCGCTCACCCATGGCACGATCTCNAGATaGGACCTGAAGCTC
CAAATGTTTTCAATGTTGTCATTGAGATATCGAAAGGCAGTAAAGTCAAATATGAGCTTGACAAGAAAACTGGTCTCATTAAGGTTGATC
GCGXTCCTATACTCATCAATGGTGTACCCCCAGAACTATGGCTTCATTCCTCGGACTTTATgTGAAGATAATGACCCCATGGATGTACTA
GTGCTCATGCAGGAGCCTGTTCTCCCAGGCTGTTTCCTTCGAGCTAGGGCCATAGGTTTAATGCCTATGATTGATCAGGGTGAGAAGGAT
GATAAGATAATAGCAGTTTGTGCTGACGATCCAGAATATCGCCACTACACTGATATTAACCAGCTTGCTCCTCACCGTCTGGCAGAAATC
CGCCGCTTTTTTGAAGACTACAAGAAGCTTGAGAACAAGGAGGTTGCTGTCAATGAGTTCCTGCCTCCAAGCACTGCTGTCCAAGCCATA
CAATATTCAATGGACCTTTATGCCGAATACATATTACAGACACTGAGAAAGTAA(3')TCTACACTTTTATGTTATGATTGTTGTGTTTA
TCTTTCATAAGTATTTTCTTTGTATTTGTGGGGGGGAGGGGTGAAATTCTATAGCGCATTACATGTCATTCAATTCAGTACTTGTAGTCA
ATTGTATTGAAACTTCAAGTACCGACTAGTCTATTAGCATGTTGAATCCTATGGGCTTGGTTGATCCACACCAAAGATATAAAAAAAAAA
AAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan