ESTScan Details for Unigene SGN-U325238

Score 
483
Direction 
Forward
Predicted Peptide Sequence 
MAKVYTLAEVSQHNSAKDCWLVINGKVYDVTKFLDDHPGGDEVLISSTGKDATDDFEDVGHSSSARAMLDEYYVGDIDSATIPTKTKYTP
PKQPQYNQDKTSEFVVKLLQFLVPLIILGVAFGIPSIPNSQQLEDGVHGEYIVKCRRESPKIVWGW
Predicted Coding Sequence 
ATGGCTAAGGTCTACACTTTGGCTGAGGTCTCCCAGCACAACAGCGCTAAGGATTGTTGGTTGGTTATTAATGGCAAGGTATATGATGTG
ACAAAATTCTTGGATGATCACCCTGGAGGTGATGAGGTTCTCATATCTTCAACTGGAAAGGATGCGACTGATGATTTTGAGGATGTAGGC
CACAGCAGCAGTGCTCGAGCAATGTTGGATGAGTACTATGTAGGTGATATTGATTCAGCAACCATTCCGACCAAAACCAAGTATACTCCT
CCCAAGCAGCCTCAGTACAACCAGGACAAAACATCAGAGTTTGTCGTCAAGCTCCTCCAGTTCTTAGTTCCCCTGATTATTTTGGGTGTG
GCTTTTGGCATCCCTTCTATACCAAACAGTCAGCAGCTTGAAGATGGAGTTCATGGGGAATACATAGTTAAGTGTCGAAGAGAGAGCCCA
AAAATAGTTTGGGGGTGG
Edits in Original Sequence 
TCGTTTCCTCCGAACAAGCCCTTTTCTCTCTTCAAGCCTTCTTCACAAGTCTTGAAGAGCCTAAATTTTGATCTTTTTTGGTTCTTGTTT
GTTCATAA
(5')ATGGCTAAGGTCTACACTTTGGCTGAGGTCTCCCAGCACAACAGCGCTAAGGATTGTTGGTTGGTTATTAATGGCAAG
GTATATGATGTGACAAAATTCTTGGATGATCACCCTGGAGGTGATGAGGTTCTCATATCTTCAACTGGAAAGGATGCGACTGATGATTTT
GAGGATGTAGGCCACAGCAGCAGTGCTCGAGCAATGTTGGATGAGTACTATGTAGGTGATATTGATTCAGCAACCATTCCGACCAAAACC
AAGTATACTCCTCCCAAGCAGCCTCAGTACAACCAGGACAAAACATCAGAGTTTGTCGTCAAGCTCCTCCAGTTCTTAGTTCCCCTGATT
ATTTTGGGTGTGGCTTTTGGCATCCgCTTCTATACCAAACAGTCAGCAGCTTGAAGATGGAGTTCATGGGGAATACATAGTTAAGTGTCG
AAGAGAGAGCCCAAAAATAGTTTGGGGGTGG(3')GTGAGGCTCTTTGTCATCTGAGCAAGTCTTGGTTAAATTATAGGGATAGTAAGAA
ACTGTCTTTTGTAGTGATATGGTCTTTTTTTTTAATGGTACTCCTTAAGATTTTTTTTGTTTCTGCAGTTGATAGTCTCTGCAAATTGAA
TTCCCTGTTTGGGTATTGATTTATTAAGATATTTCCATTTTCTTTGAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan