ESTScan Details for Unigene SGN-U325300

Score 
510
Direction 
Forward
Predicted Peptide Sequence 
PNELSSLQILKSGDGFXIDEFLVKRMEHFVALSPPSPASPTLIGDGVFAENSVGDAASDLVGILFGFDKELIQKTKQAPWYMAVYLLLLV
ATLAKYFVVSSSSPGYVLDAMRAINETDASRNRETITSTQPASSKNGSVVITINRNQLEKNLLGSVTTSWEKLVMDMYPPGTSVRTVTCT
YCNIVQPPRAKHCHDCNKCILQFDHHCVWLGSCVDRVTIAGFGGIFARKQPFLFGLAPYYSILDISPIKAMVVICNCFLAVSCFVYLPLL
SSSPPHIPQLSYFDKSDHLRGSX
Predicted Coding Sequence 
XCACCAAACGAACTCTCATCACTGCAAATTCTTAAATCTGGAGATGGATTCXCCATTGACGAATTTTTAGTGAAGAGGATGGAGCATTTT
GTGGCGCTTTCTCCTCCTTCCCCGGCCTCTCCAACCCTGATCGGAGATGGAGTTTTTGCTGAAAATAGTGTTGGTGATGCTGCATCTGAC
CTTGTCGGTATTCTATTCGGTTTTGACAAAGAGTTGATTCAAAAAACTAAACAAGCCCCCTGGTACATGGCAGTTTATTTGCTGCTGCTT
GTTGCTACACTGGCTAAATACTTCGTTGTATCTAGTTCTTCTCCTGGCTATGTTCTTGATGCAATGAGAGCTATCAATGAGACAGATGCA
TCGCGTAATAGGGAAACAATTACCTCTACACAGCCTGCTTCGAGCAAAAATGGCAGTGTAGTTATCACAATCAACAGGAACCAGTTAGAA
AAGAATCTTCTAGGGAGTGTTACAACTTCCTGGGAAAAGCTAGTGATGGATATGTATCCTCCAGGAACATCTGTTAGAACTGTGACTTGC
ACTTACTGTAATATAGTGCAGCCTCCACGAGCTAAGCACTGTCATGATTGTAACAAATGCATTCTCCAGTTTGATCATCACTGTGTTTGG
CTTGGCTCATGCGTGGACAGGGTAACCATTGCTGGTTTTGGTGGTATCTTTGCTCGGAAACAGCCTTTTCTCTTTGGACTGGCACCTTAT
TATTCAATACTTGATATCTCACCTATCAAAGCCATGGTGGTCATATGCAATTGTTTTCTTGCTGTTAGCTGTTTTGTCTATTTGCCTCTT
CTTTCTTCTTCTCCTCCTCATATTCCACAGCTATCTTATTTTGACAAATCAGATCACTTACGAGGTTCTTXX
Edits in Original Sequence 
(5')XCACCAAACGAACTCTCATCACTGCAAATTCTTAAATCTGGAGATGGATTCXCCATTGACGAATTTTTAGTGAAGAGGATGGtAGC
ATTTTGTGGCGCTTTCTCCTCCTTCCCCGGCCTCTCCAACCCTGATCGGAGATGGAGTTTTTGCtTGAAAATAGTGTTGGTGATGCTGCA
TCTGACCTaTGTCGGTATTCTATTCGGTTTTGACAAAGAGTTGATTCAAAAAACTAAACAAGCCCCCTGGTACATGGCAGTTTATTTGCT
GCTGCTTGTTGCTACACTGGCTAAATACTTCGTTGTATCTAGTTCTTCTCCTGGCTATGTTCTTGATGCAATGAGAGCTATCAATGAGAC
AGATGCATCGCGTAATAGGGAAACAATTACCTCTACACAGCCTGCTTCGAGCAAAAATGGCAGTGTAGTTATCACAATCAACAGGAACCA
GTTAGAAAAGAATCTTCTAGGGAGTGTTACAACTTCCTGGGAAAAGCTAGTGATGGATATGTATCCTCCAGGAACATCTGTTAGAACTGT
GACTTGCACTTACTGTAATATAGTGCAGCCTCCACGAGCTAAGCACTGTCATGATTGTAACAAATGCATTCTCCAGTTTGATCATCACTG
TGTTTGGCTTGGCTCATGCGTaGGACAGGGTAACCATTGCTGGTTTTGGTGGTATCTTTGCTCGGAAACAGCCTTTTCTCTTTGGACTGG
CACCTTATaTATTCAATACTTGATATCTCACCTATCAAAGCCATGGTGGTCATATGCAATTGTTTTCTTGCTGTTAGCTGTTTTGTCTAT
TTGCCTCTTCTTTCTTCTTCTCCTCCTCATATTCCACAGCTATCTTATTTTGACAAATCAGATCACTTACGAGGTTCTTXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan