ESTScan Details for Unigene SGN-U325347

Score 
512
Direction 
Forward
Predicted Peptide Sequence 
KDXNIGVIGLGGLGHLAIKFAKAFGHHVTVISTSLSKEKEAKTKLGADDFIVSSNPQQMKSRHRSLDFILDTVSANHSLGPYLELLKIKG
TFVIVGAPDKPMDLPSFPLIFGKRTVKGSMIGSIKETQEMMDICGKFNIMCDIEIITPHQINEAYERIEKNDIKYRFVIDIAGQSSKL
Predicted Coding Sequence 
AAAGACAAXAATATAGGAGTCATTGGTTTGGGAGGATTAGGTCATTTGGCTATTAAATTTGCAAAAGCTTTTGGACATCATGTCACTGTC
ATAAGCACTTCTTTATCAAAAGAAAAAGAAGCCAAAACCAAATTAGGTGCTGATGATTTCATTGTTAGCTCTAATCCACAACAAATGAAG
TCAAGGCATAGGAGTTTGGACTTCATATTGGACACAGTCTCAGCCAATCACTCTCTTGGGCCTTACTTGGAATTGCTTAAAATTAAAGGA
ACTTTTGTGATAGTGGGTGCACCAGATAAGCCCATGGACCTTCCATCATTTCCATTAATATTTGGTAAAAGAACAGTGAAAGGGAGCATG
ATTGGAAGTATAAAAGAAACACAAGAAATGATGGACATTTGTGGGAAGTTCAACATCATGTGTGACATAGAGATAATCACACCTCATCAG
ATAAATGAAGCTTATGAAAGAATTGAGAAGAATGATATTAAGTATCGCTTTGTGATCGACATTGCTGGTCAATCATCGAAACTTTAA
Edits in Original Sequence 
(5')AAAGACAAXAATATAGGAGTCATTGGTTTGGGAGGATTAGGTCATTTGGCTATTAAATTTGCAAAAGCTTTTGGACATCATGTCAC
TGTCATAAGCACTTCTTTATCAAAAGAAAAAGAAGCCAAAACCAAATTAGGTGCTGATGATTTCATTGTTAGCTCTAATCCACAACAAAT
GAAGTCAAGGCATAGGAGTTTGGACTTCATATTGGACACAGTCTCAGCCAATCACTCTCTTGGGCCTTACTTGGAATTGCTTAAAATTAA
AGGAACTTTTGTGATAGTGGGTGCACCAGATAAGCCCATGGACCTTCCATCATTTCCATTAATATTTGGTAAAAGAACAGTGAAAGGGAG
CATGATTGGAAGTATAAAAGAAACACAAGAAATGATGGACATTTGTGGGAAGTTCAACATCATGTGTGACATAGAGATAATCACACCTCA
TCAGATAAATGAAGCTTATGAAAGAATTGAGAAGAATGATATTAAGTATCGCTTTGTGATCGACATTGCTGGTCAATCATCGAAACTTTA
A(3')GTTCTTTAGGGAACTTTTCGAGTTTTAAGTATCGATATATTGAGTTGGATGAGTATTTCATGTACTAGGTATGCTTATTTATAAG
TATGAGTTGAATACTTTGTTTTTGTGCTTTGGTACACACTTGTAAATAATTACCTTTTGGGTTTACCAGTGTTATGGGCTTCAGCCCATA
TACCGTATTGGGCTTGATTCTACATGATAGATCGGAAGGACAATCGTATATGTGGCCCAATGATGTGTAGTCTCTTGGGCTTAGACTTAT
ATTTCATCAACTTCATAATATAGCACCAAAGCTAATAGGGAAAACAAAGCATGTTCTAGTTACTTCTCACTATTCTACGACAAATAAAGA
ATTTAACGATGTTATTATATTATATTTATCATAATAAATAATATGAGTATTTATAATCAAAAAAAAAAAAAAAAACTCGAGACTATTCTC
TCCTCAAGTTTTTTTTTTTTTTTTTTTTTTTTTTAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan