ESTScan Details for Unigene SGN-U325355

Score 
522
Direction 
Reverse
Predicted Peptide Sequence 
SIPEEFKNLTLLMDLDLHSNRFSGNLRAILSKNFQDPLGHYNSIDLAYNMFNGPLDENIGNEPVMDSILSLSLSHNPLTGHIPKSLGNLT
TLQEIKLAENGLTGGIPTELGNAKELKTILLSNNNLEGAIPAQVLNLKDLQEFDVSENRLSGSIPPHKAKIPKSAFLGNHGLCGAPLPPC
SHTXW
Predicted Coding Sequence 
TCGATCCCTGAGGAATTCAAGAACCTGACACTGCTGATGGATCTTGATCTTCACTCAAACAGATTTTCAGGCAACTTGAGAGCAATTTTG
TCCAAGAATTTTCAAGACCCCCTTGGCCACTACAATTCTATTGATCTTGCATACAACATGTTCAATGGACCATTAGACGAAAACATAGGG
AATGAACCTGTCATGGACTCTATTTTGTCACTAAGTTTGTCCCACAATCCATTAACAGGACACATACCAAAATCACTGGGAAATTTGACA
ACTTTGCAGGAAATTAAACTAGCTGAGAATGGGCTAACAGGTGGGATTCCAACAGAACTTGGGAATGCCAAAGAACTGAAAACAATTCTA
CTTTCAAATAACAATTTGGAAGGTGCAATACCAGCTCAGGTTCTGAATTTGAAAGACCTACAAGAATTTGATGTATCGGAAAATCGACTA
AGCGGTAGTATCCCTCCTCATAAAGCTAAAATCCCAAAGTCTGCATTTTTGGGAAATCATGGCTTGTGTGGAGCTCCACTTCCTCCTTGT
AGCCACACATAGTGG
Edits in Original Sequence 
(5')TCGATCCCTGAGGAATTCAAGAACCTGACACTGCTGATGGATCTTGATCTTCACTCAAACAGATTTTCAGGCAACTTGAGAGCAAT
TTTGTCCAAGAATTTTCAAGACCCCCTTGGCCACTACAATTCTATTGATCTTGCATACAACATGTTCAATGGACCATTAGACGAAAACAT
AGGGAATGAACCTGTCATGGACTCTATTTTGTCACTAAGTTTGTCCCACAATCCATTAACAGGACACATACCAAAATCACTGGGAAATTT
GACAACTTTGCAGGAAATTAAACTAGCTGAGAATGGGCTAACAGGTGGGATTCCAACAGAACTTGGGAATGCCAAAGAACTGAAAACAAT
TCTACTTTCAAATAACAATTTGGAAGGTGCAATACCAGCTCAGGTTCTGAATTTGAAAGACCTACAAGAATTTGATGTATCGGAAAATCG
ACTAAGCGGTAGTATCCCTCCTCATAAAGCTAAAATCCCAAAGTCTGCATTTTTGGGAAATCATGGCTTGTGTGGAGCTCCACTTCCTCC
TTGTAGCCACACATAGTGG(3')AAACCTTCAAACACAATATCTCCCTTTTACTTTATTTATTCTTCATTTTCGACATGATTATTCGTCA
TAATGTATTGTATTTCAGTTGTAATCAAAAAAAAAAAAAAAATGCAATCGAGATATATAAACAGAAAACATAAAAATAAACCNNAAAAAA
AAAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan