ESTScan Details for Unigene SGN-U325369

Score 
867
Direction 
Forward
Predicted Peptide Sequence 
KGRAIYHDLNAYRILFDQDGNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYMRTGRVTSESVVYSFGTMLLDLLSGKHIPPSHALDXDPGE
EFIDVDGFLFGGDFSNDDGTELVRLATRCLQYEARERPNAKSLVNSLITIQKETEVPSHVLLGIRHGAATPPQPLVLTTMGEACLRRDLT
ALHEILQKTGYKDDEGIANELSFQMWTNQMQETLNSKQQGDAAFRAKDFITAIECYTQFNDGGTMVSPTIYARRCLCYLMSDMAQEALGD
AMQAQVISSEWPTAFYLQSVALFTLGMENDAQEALKEATKLEGKKSKN
Predicted Coding Sequence 
XGTAAGGGTCGAGCAATATATCATGATCTTAATGCTTACAGAATCTTGTTTGATCAGGATGGTAATCCTAGACTATCTTGCTTTGGCCTG
ATGAAGAACAGTAGAGATGGAAAAAGTTATAGTACAAACTTGGCATTCACACCTCCAGAGTACATGAGAACAGGAAGAGTGACATCTGAA
AGTGTAGTTTACAGCTTTGGAACAATGTTGCTAGATCTTTTGAGTGGAAAACATATACCTCCAAGCCATGCACTTGATXCTGATCCGGGT
GAAGAATTTATCGATGTTGATGGATTCTTGTTTGGAGGTGATTTTTCTAATGATGATGGAACCGAGCTAGTGCGGCTAGCCACCCGTTGT
TTACAGTATGAAGCACGTGAGAGGCCAAATGCAAAATCTCTTGTTAATTCTCTTATTACCATTCAGAAAGAAACAGAGGTACCATCACAT
GTTTTGCTGGGAATTAGACATGGAGCTGCAACCCCACCCCAACCATTGGTGTTGACAACAATGGGTGAAGCATGTCTGAGAAGAGATCTG
ACTGCCCTTCATGAGATATTGCAAAAGACGGGGTACAAGGATGATGAAGGAATTGCCAATGAGCTTTCTTTCCAAATGTGGACAAATCAG
ATGCAGGAAACCTTGAACTCTAAGCAACAAGGAGATGCTGCTTTCCGAGCCAAGGATTTCATAACAGCCATTGAATGCTACACACAGTTC
AATGATGGAGGGACCATGGTGTCACCCACCATATACGCGAGGCGCTGCTTGTGTTATCTGATGAGCGACATGGCACAAGAAGCTTTAGGA
GATGCAATGCAAGCTCAGGTTATATCCTCTGAGTGGCCTACCGCCTTTTATCTCCAGTCTGTTGCCCTTTTTACCCTTGGGATGGAGAAT
GATGCTCAAGAAGCACTAAAAGAAGCCACAAAGTTGGAAGGCAAAAAGAGCAAAAATTAA
Edits in Original Sequence 
(5')XGTAAGGGTCGAGCAATATATCATGATCTTAATGCTTACAGAATCTTGTTTGATCAGGATGGTAATCCTAGACTATCTTGCTTTGG
CCTGATGAAGAACAGTAGAGATGGAAAAAGTTATAGTACAAACTTGGCATTCACACCTCCAGAGTACATGAGAACAGGAAGAGTGACATC
TGAAAGTGTAGTTTACAGCTTTGGAACAATGTTGCTAGATCTTTTGAGTGGAAAACATATACCTCCAAGCCATGCACTTGATXCTGATCC
GGGTGAAGAATTTATCGATGTTGATGGATTCTTGTTTGGAgGGTGATTTTTCTAATGATGATGGAACCGAGCTAGTGCGGCTAGCCACCC
GTTGTTTACAGTATGAAGCACGTGAGAGGCCAAATGCAAAATCTCTTGTTAATTCTCTTATTACCATTCAGAAAGAAACAGAGGTACCAT
CACATGTTTTGCTGGGAATTAGACATGGAGCTGCAACCCCACCCCAACCATTGGTGTTGACAACAATGGGTGAAGCATGTCTGAGAAGAG
ATCTGACTGCCCTTCATGAGATATTGCAAAAGACGGGGTACAAGGATGATGAAGGAATTGCCAATGAGCTTTCTTTCCAAATGTGGACAA
ATCAGATGCAGGAAACCTTGAACTCTAAGCAACAAGGAGATGCTGCTTTCCGAGCCAAGGATTTCATAACAGCCATTGAATGCTACACAC
AGTTCAATGATGGAGGGACCATGGTGTCACCCACCATATACGCGAGGCGCTGCTTGTGTTATCTGATGAGCGACATGGCACAAGAAGCTT
TAGGAGATGCAATGCAAGCTCAGGTTATATCCTCTGAGTGGCCTACCGCCTTTTATCTCCAGTCTGTTGCCCTTTTTACCCTTGGGATGG
AGAATGATGCTCAAGAAGCACTAAAAGAAGCCACAAAGTTGGAAGGCAAAAAGAGCAAAAATTAA(3')AATACTAGTGTGTAGACTTAC
ATTTCCTGATTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan