Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U325412

Score 
94
Direction 
Forward
Predicted Peptide Sequence 
TAFSVGQKQLLCLARALLKSCKVLCLDECTANVDTETTSKLQKTLATECHGTTVITIAHRISTXYEYGQYPDFGSRVPGKRTFLTSFPSF
KLSRHKXLNHKNITKVAGCFDIXLSLFGLIIYYYTYLESRGQTLFLKTKIVVLMFGTWFKALTDMNNQTSLGTQSSDHPTGEHSTIFFDY
Predicted Coding Sequence 
XXAACAGCATTTTCTGTTGGTCAAAAGCAGCTACTCTGCCTAGCACGTGCTCTCCTCAAGTCCTGCAAGGTGCTTTGCTTGGATGAATGC
ACGGCAAATGTGGACACTGAAACAACTTCAAAACTACAGAAAACTCTAGCCACCGAATGCCATGGAACAACGGTTATCACAATTGCCCAT
CGCATTTCAACAGXTTATGAGTATGGACAATATCCTGATTTTGGATCGAGGGTTCCTGGTAAACGTACTTTCTTGACAAGCTTCCCTTCG
TTTAAACTGTCTAGACATAAGAAXTTGAATCATAAGAATATAACAAAAGTAGCTGGTTGCTTTGACATTXTTTTAAGTCTCTTCGGGCTA
ATTATTTACTATTATACTTATCTGGAAAGTAGGGGTCAAACATTATTCCTTAAAACAAAGATTGTTGTTTTAATGTTCGGAACTTGGTTT
AAGGCCCTXACTGATATGAACAACCAAACAAGTCTTGGCACTCAATCTAGTGATCATCCTACTGGTGAACATTCTACAATATTCTTCGAT
TATTAG
Edits in Original Sequence 
(5')XXAACAGCATTTTCTGTTGGTCAAAAGCAGCTACTCTGCCTAGCACGTGCTCTCCTCAAGTCCTGCAAGGTGCTTTGCTTGGATGA
ATGCACGGCAAATGTGGACACTGAAACAACTTCAAAACTACAGAAAACTCTAGCCACCGAATGCCATGGAACAACGGTTATCACAATTGC
CCATCGCATTTCAACAGXTTATGAGTATGGACAATATCCTGATTTTGGATCGAGGGTTCCTGGTAAACGTACTTTCTTGACAAGCTTCCC
TTCGTTTAAACTGTCTAGACATAAGAAXTTGAATCATAAGAATATAACAAAAGTAGCTGGTTGCTTTGACATTXTTTTAAGTCTCTTCGG
GCTAATTATTTACTATTATACTTATCTGGAAAGTAGGGGTCAAACATTATTCCTTAAAACAAAGATTGTTGTTTTAATGTTCGGAACTTG
GTTTAAGGCCCTXACTGATATGAACAACCAAACAAGTCTTGGCACTCAATCTAGTGATCATCCTACTGGTGAACATTCTACAATATTCTT
CGATTATTAG(3')ATTGATGCATGTTATATAAGAGGAACGAAGCAGAAAAAGAAAGATCATCCCAATTGTGATTGTTCTAGTTCCTCAT
TTTACTTTTTTTTTTTTTTTTTTTTGCTTTACAGGTTGAACAGGGTAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan