ESTScan Details for Unigene SGN-U325472

Score 
342
Direction 
Forward
Predicted Peptide Sequence 
RCIYKDFDYFKVEVDGNTDNDSAVFHPFEFSSASPPSIMTEGSQSGSWRKKITDLDGTEDEKDMPWWVIDCVMNNRLPPRENTKCSFYFH
PCEGSTVQILTQGKLSAPRILRIHKVINYVVEKLVLDKPLDSVNSDGTFAPGLHGTTGVDXLIPDWAEAFAKAKPSIEILCNNQVLSPEM
SLATVRAYIWKKPEDLVLNYRLLPTSDRPESYKVRSGLKNGSLSIQNTSEGTQSAMVLAAGVICWLLYIRKPDGWIHLQNLNENPILPFP
H
Predicted Coding Sequence 
XXAAGATGTATCTACAAGGATTTTGACTACTTCAAGGTGGAAGTAGACGGCAACACTGATAATGATTCTGCGGTGTTCCATCCCTTTGAA
TTTTCTTCAGCATCTCCTCCATCCATCATGACTGAGGGCTCTCAAAGTGGCTCTTGGAGGAAAAAGATCACTGACTTAGATGGAACTGAA
GATGAGAAGGACATGCCTTGGTGGGTTATAGACTGTGTGATGAACAATCGTCTGCCTCCCAGGGAAAATACCAAATGTAGCTTTTATTTT
CATCCATGTGAGGGTTCTACTGTCCAGATCCTTACCCAAGGCAAACTGAGTGCACCTCGCATATTAAGAATTCACAAAGTTATCAATTAT
GTCGTGGAAAAGTTGGTTCTTGACAAGCCTTTGGATAGCGTAAACTCGGATGGGACTTTTGCTCCTGGTTTACATGGAACTACTGGAGTG
GATGAXCTCATCCCGGATTGGGCCGAAGCCTTCGCAAAAGCAAAGCCATCTATAGAGATCCTGTGCAATAACCAGGTTTTATCCCCTGAA
ATGAGCTTAGCAACTGTACGGGCCTATATATGGAAGAAACCTGAAGATCTTGTACTTAATTACCGTCTGTTGCCAACAAGTGACAGGCCT
GAAAGTTATAAGGTTCGGAGTGGCTTGAAAAATGGGTCTCTGTCCATACAGAATACTTCTGAGGGTACGCAATCTGCTATGGTGCTTGCT
GCTGGCGTTATTTGTTGGTTGTTGTATATCCGAAAACCAGATGGTTGGATTCATTTGCAAAATCTTAATGAAAATCCAATTTTACCATTT
CCCCATTGA
Edits in Original Sequence 
(5')XXAAGATGTATCTACAAGGATTTTGACTACTTCAAGaGTGGAAGTAGACGGCAACACTGATAATGATTCTGCGGTGTTCCATCCCT
TTGAATTTTCTTCAGCATCTCCTCCATCCATCATGACTGAGGGCTCTCAAAGTGGCTCTTGGAGGAAAAAGATCACTGACTTAGATGGAA
CTGAAGATGAGAAGGACATGCCTTGGTGGGTTATAGACTGTGTGATGAACAATCGTCTGCCTCCCAGGGAAAATACCAAATGTAGCTTTT
ATTTTCATCCATGTGAGGGTTCTACTGTCCAGATCCTTACCCAAGGCAAACTGAGTGCACCTCGCATATTAAGAATTCACAAAGTTATCA
ATTATGTCGTGGAAAAGTTGGTTCTTGACAAGCCTTTGGATAGCGTAAACTCGGATGGGACTTTTGCTCCTGGTTTACATGGAACTACTG
GAGTGGATGAXCTCATCCCGGATTGGGCCGAAGCCTTCGCAAAAGCAtAAGCCATCTATAGAGATCCTGTGCAATAACCAGGTTTTATCC
CCTGAAATGAGCTTAGCAACTGTACGGGCCTATATATGGAAGAAACCTGAAGATCTTGTACTTAATTACCGTCTGTTGCCAAgCAAGTGA
CAGGCCTGAAAGTTATAAGGTTCGGAGTGGCTTGAAAtAATGGGTCTCTGTCCATACAGAATACTTCTGAGGGTACGCAATCTGCTATGG
TGCTTGCTGCTGGCGTTATTTGTTGGTTGTTGTATATCCGAAAACCAGATGGTTGGATTCATTTGCAAAATCTTAATGAAAATCCAATTT
TACCATTTCCCCATTGA(3')ATGATGGAAAATAGTTGTCAAACCCTATTGAAGAAATGGAAGGTTTCTATGGCTAGTAGGTCAATTACA
AAGTTTATATAAGTTAAGTTTGCATGCGGTATAGGTTTTCATTTGGAGGAAACATGATATCATATTAGAAGATCTTAGGTTTGTAGATTT
GTATTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan