ESTScan Details for Unigene SGN-U325498

Score 
723
Direction 
Forward
Predicted Peptide Sequence 
KCLLLNAPRIIQQLIDHSIGDPHTMNAGLMSLPFALVENHPVSPKNDKGDILLPNGENWRSQLLLLCYSIKILSEVDSIMKDQDLHDHRK
LFGFPKRSLPLPYFLSSLLQSNVHPKVSNNQVGGDIGSDIELVHSSDSDQEVDDYDDLPPFRPLRKSQIAKLSKEQKRAYFDEYDYRVKL
FQKKQWREELKRLRDMKKKGKAEIGDYMEEGADQETGSQAGAAIPLPDMVLPNSFDGDNPTYRYRYLEPSSQLLARPVMDSQSWDHDCGY
X
Predicted Coding Sequence 
AAATGTTTGTTGCTCAATGCTCCXCGTATCATTCAACAGTTAATTGATCACTCCATAGGTGATCCACACACGATGAATGCTGGGTTGATG
AGTCTTCCATTTGCTCTTGTTGAAAACCACCCAGTCAGTCCAAAGAATGACAAAGGAGATATATTGCTTCCAAATGGAGAAAATTGGAGA
TCGCAGCTTCTGCTTCTGTGTTACTCAATAAAGATTTTATCAGAAGTAGATTCCATCATGAAAGATCAAGATCTTCATGACCACAGAAAG
CTTTTTGGCTTCCCCAAGCGTTCACTCCCTTTACCATACTTTTTATCTTCACTGTTACAATCAAATGTTCATCCTAAAGTCTCTAACAAT
CAAGTTGGTGGGGATATAGGCTCAGACATTGAGCTGGTACATTCATCTGATTCCGATCAAGAAGTTGATGATTACGATGACCTTCCACCT
TTCAGACCTTTGAGGAAATCTCAAATTGCTAAGCTGAGCAAGGAGCAGAAGAGAGCATATTTTGACGAGTATGATTACCGTGTGAAGCTG
TTTCAGAAGAAACAATGGAGGGAGGAGTTAAAAAGGCTTCGGGACATGAAGAAGAAAGGCAAGGCAGAGATAGGTGATTACATGGAAGAA
GGTGCTGACCAGGAAACAGGGAGCCAAGCAGGAGCAGCAATCCCTTTACCCGACATGGTGCTCCCCAATTCTTTTGACGGGGACAACCCA
ACTTACAGATACCGGTATCTAGAACCTTCGTCTCAACTTCTTGCAAGGCCTGTTATGGACTCCCAGAGCTGGGACCATGATTGTGGATAT
GXX
Edits in Original Sequence 
(5')AAATGTTTGTTGCTCAATGCTCCXCGTATCATTCAACAGTTAATTGATCACTCCATAGGTGATCCACACACGATGAATGCTGGGTT
GATGAGTCTTCCATTTGCTCTTGTTGAAAACCACCCAGTCAGTCCAAAGAATGACAAAGGAGATATATTGCTTCCAAATGGAGAAAATTG
GAGATCGCAGCTTCTGCTTCTGTGTTACTCAATAAAGATTTTATCAGAAGTAGATTCCATCATGAAAGATCAAGATCTTCATGACCACAG
AAAGCTTTTTGGCTTCCCCAAGCGTTCACTCCCTTTACCATACTTTTTATCTTCACTGTTACAATCAAATGTTCATCCTAAAGTCTCTAA
CAATCAAGTTGGTGGGGATATAGGCTCAGACATTGAGCTGGTACATTCATCTGATTCCGATCAAGAAGTTGATGATTACGATGACCTTCC
ACCTTTCAGACCTTTGAGGAAATCTCAAATTGCTAAGCTGAGCAAGGAGCAGAAGAGAGCATATTTTGACGAGTATGATTACCGTGTGAA
GCTGTTTCAGAAGAAACAATGGAGGGAGGAGTTAAAAAGGCTTCGGGACATGAAGAAGAAAGGCAAGGCAGAGATAGGTGATTACATGGA
AGAAGGTGCTGACCAGGAAACAGGGAGCCAAGCAGGAGCAGCAATCCCTTTACCCGACATGGTGCTCCCCAATTCTTTTGACGGGGACAA
CCCAACTTACAGATACCGGTATCTAGAACCTTCGTCTCAACTTCTTGCAAGGCCTGTTATGGACTCCCAGAGCTGGGACCATGATTGTGG
ATATGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan