ESTScan Details for Unigene SGN-U325555

Score 
310
Direction 
Forward
Predicted Peptide Sequence 
NFFDRRNITGGSPVNFSDXPYTTGFLIRNFSGRRPTGRLFRSFSVGGKKRRRERTMLSLNNTLPTISVHQRISFVSTIFAQKRVIFRTMD
KNQRVLLSSSQQTENSSSILSCKASLEVVHDSPSGSAVHGLSETVVGVLGGGAAGSYAGEAASQMAIKMIVLDPMENCPASALAHQHVVG
SYDDSATVEEFGKRCGVLTVEIEHV
Predicted Coding Sequence 
AACTTCTTCGACCGCCGTAATATAACCGGTGGCTCTCCCGTTAACTTTTCCGACAXGCCGTATACCACCGGTTTCCTCATTCGCAACTTC
TCCGGCCGCCGGCCGACTGGTAGGCTCTTCCGCAGCTTCTCAGTTGGTGGAAAGAAAAGAAGAAGAGAAAGGACAATGTTGAGCTTAAAC
AACACTCTCCCAACTATTTCTGTTCATCAAAGAATCTCTTTCGTTTCTACAATTTTTGCTCAAAAGAGGGTTATTTTTCGTACTATGGAC
AAAAATCAGCGTGTTTTGTTGTCATCATCGCAGCAAACTGAGAATAGCTCTTCTATATTGTCTTGTAAAGCTTCATTGGAAGTTGTACAT
GACTCACCCAGTGGTTCAGCAGTCCATGGACTATCGGAAACGGTTGTGGGTGTTTTGGGAGGAGGXGCAGCTGGGTCGTATGCTGGTGAA
GCAGCATCCCAAATGGCAATTAAAATGATTGTCTTGGATCCAATGGAGAATTGTCCTGCTAGTGCACTAGCACATCAACATGTGGTGGGA
AGTTATGATGACAGTGCCACAGTTGAAGAATTTGGGAAAAGGTGTGGAGTACTAACGGTTGAGATTGAGCATGTT
Edits in Original Sequence 
(5')AACTTCTTCGACCGCCGTAATATAACCGGTcGGCTCTCCCGTTAACTTTTCCGACAXGCCGTATACCACCGGTTTCCTCATTCGCA
ACTTCTCCGGCCGCCGGCCGACTGGTAGGCTCTTCCGCAGCTTCTCAGTTGGTGGAAAGAAAAGAAGAAGAGAAAGGACAATGTTGAGCT
TAAACAACACTCTCCCAACTATTTCTGTTCATCAAAGAATCTCTTTCGTTTCTACAATTTTTGCTCAAAAGAGGGTTATTTTTCGTACTA
TGGACAAAAATCAGCGTGTTTTGTTGTCATCATCGCAGCAAACTGAGAATAGCTCTTCTATATTGTCTTGTAAAGCTTCATTGGAAGTTG
TACATGACTCACCCAGTGGTTCAGCAGTCCATGGACTATCGGAAACGGTTGTGGGTGTTTTGGGAGGAGGXGCAGCTGGGTCGTATGCTG
tGTGAAGCAGCATCCCAAATGGCAATTAAAATGATTGTCTTGGATCCAATGGAGAATTGTCCTGCTAGTGCACTAGCACATCAACATGTG
GTGGGAAGTTATGATGACAGTGCCACAGTTGAAGAATTTGGGAAAAGGTGTGGAGTACTAACGGTTGAGATTGAGCATGTT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan